KEGG   Mus musculus (mouse): 23806
Entry
23806             CDS       T01002                                 

Gene name
Arih1, AU021774, Ari, Ari1, Hari, Hhari, Ubch7bp, Uip77
Definition
(RefSeq) ariadne RBR E3 ubiquitin protein ligase 1
  KO
K11968  ariadne-1 [EC:2.3.2.31]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    23806 (Arih1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     23806 (Arih1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    23806 (Arih1)
SSDB
Motif
Pfam: IBR zf-C3HC4_2 zf-RING_5 zf-RING_14 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_4
Other DBs
NCBI-GeneID: 23806
NCBI-ProteinID: NP_064311
MGI: 1344363
Ensembl: ENSMUSG00000025234
Vega: OTTMUSG00000035819
UniProt: Q9Z1K5
Position
9; 9 B
AA seq 555 aa
MDSDEGYNYEFDEDEECSEEDSGAEEEEDDDEDEPDDDNLDLGEVELVEPGLGVGGERDG
LLCGETGGGGGSALGPGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNE
VIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQ
DMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDD
NTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQ
FCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVC
RNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYM
NHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYL
KKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQH
VHEGYEKDLWEYIED
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggactcggacgagggctacaactacgagttcgacgaggacgaggagtgcagcgaggag
gacagcggcgccgaggaggaggaggacgacgacgaggacgagccggacgatgataacctg
gatctgggcgaggtggagctggtggagcccgggctgggcgtcggcggggagcgagacgga
ctgctgtgcggggagactggcggtggcggcggcagcgctctgggtccgggaggcggcggc
ggcggtggcggtggcggcggcggcccgggacacgagcaggaggaggattaccgctacgag
gtgctcacggccgaacagatcctgcagcacatggtggaatgtatccgggaggtcaacgag
gtcatccagaatccagcaactatcacgagaatactccttagccacttcaattgggataaa
gagaagctaatggaaaggtactttgatggaaacctggagaagctctttgctgagtgtcat
gtaattaatccaagtaaaaagtctcgaactcgccagatgaatacaaggtcatcggcacag
gatatgccgtgtcagatctgctacttgaactaccctaactcgtattttactggccttgaa
tgtggacataagttttgtatgcagtgctggagtgaatatttaactacaaaaataatggag
gaaggcatggggcagactatttcgtgtcctgcgcatggttgtgatatcttagtggatgac
aacacagttatgcgcctgatcacagattccaaagttaagttaaaatatcaacatttaata
acaaatagctttgtagagtgcaaccgactgttaaagtggtgtcctgccccagattgccac
catgttgttaaagtccagtatcctgatgcaaaaccagttcgctgcaaatgtggccgccag
ttttgctttaactgtggtgaaaattggcatgatccagttaaatgtaagtggttgaagaag
tggattaaaaagtgtgatgatgacagtgaaacttctaattggattgcagctaacacaaag
gaatgtcccaaatgccatgtcacaattgagaaggatggcggttgtaatcacatggtctgt
cgtaaccagaactgtaaagcagaattttgctgggtgtgtcttggcccttgggaaccgcat
ggatctgcctggtacaactgtaaccgctataatgaggatgatgcaaaggcagcaagagat
gcccaagagcgatctagggcggccctgcagagatacctgttctactgtaatcgctatatg
aaccacatgcagagtctacgcttcgagcataagctgtatgctcaggtgaaacagaagatg
gaggagatgcagcagcacaacatgtcctggatcgaggtgcagttcctgaagaaagcagtt
gatgtcctctgccagtgtcgtgccacactcatgtacacttatgtcttcgctttctacctc
aaaaagaataaccagtccattatctttgagaataatcaagcagatctagaaaatgccaca
gaggtgctttcgggctaccttgaacgagatatttcccaagattctctgcaagatataaag
cagaaagtccaagataagtacagatactgtgagagtcgacgaagggttttgttacagcat
gtgcatgaaggctatgaaaaagatctgtgggagtacattgaggactga

DBGET integrated database retrieval system