KEGG   Mus musculus (house mouse): 238076
Entry
238076            CDS       T01002                                 
Symbol
Kcns3
Name
(RefSeq) potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
  KO
K04933  potassium voltage-gated channel delayed-rectifier subfamily S member 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    238076 (Kcns3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   238076 (Kcns3)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Other DBs
NCBI-GeneID: 238076
NCBI-ProteinID: NP_001162036
MGI: 1098804
Ensembl: ENSMUSG00000043673
UniProt: Q8BQZ8
Position
12:complement(11140203..11201612)
AA seq 491 aa
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR
YQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDEHKSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDME
VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY
NTASLENCTGK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggtgtttggtgagtttttccatcgccctggacaagatgaggaacttgtcaacttgaac
gtggggggctttaagcagtctgtggatcaaagtacactcctgcggttccctcacacacga
ctgggaaagctgcttacctgccactctgaggaggccattctggagctgtgtgatgactac
agcgtggcagataaagagtactactttgatcggaaccccttcctgttcagatacgtcttg
aacttttattacacagggaagctgcatgtgatggaggaactgtgtgtcttctccttctgc
caggagatcgagtactggggcatcaatgagctcttcattgactcctgctgtagcagtcgg
taccaggagcgcaaggaggagagccacgacaaggactgggaccagaaaagcaacgatgtg
agcacagactcctcctttgaagaatcgtctctgtttgagaaagagctggagaagtttgat
gagctgagatttggtcagctccgaaagaagatctggattcgaatggaaaatccagcttac
tgcctgtcggccaagctcattgccatctcctccttgagcgtggtgctggcttccatagtg
gccatgtgtgtgcacagcatgtcggaattccagaacgaggatggagaagtggatgaccct
gtgctggaaggtgtggagattgcctgcattgcatggtttactggtgagctagccatcagg
ctggttgctgctccatcacaaaagaagttctggaaaaaccctctgaacatcattgacttt
gtttctatcattcccttctatgccacgttggctgtggacaccaaggaagaagagagtgag
gacattgagaatatgggcaaggtggtccagatccttcggctcatgaggattttccgaatt
ctgaagcttgcccggcactctgtagggcttcggtctcttggggccacactgaggcacagt
taccatgaggtggggctactgcttctcttcctttctgtgggcatctccatcttctctgtg
cttatctactctgtggagaaagatgaacacaagtccagtctcaccagcatccccatctgc
tggtggtgggccactatcagtatgaccacagtgggctatggagacacccacccagtcacc
ttagctgggaaaatcattgcaagcacatgtattatctgtggaatcttagtggtagccctc
cccattaccatcatcttcaacaagttttccaagtactaccagaagcagaaagacatggaa
gtggaccagtgcagcgaggacccaccagagaagtgccatgagctaccgtactttaacatt
agggacgtttatgcacagcaagtacatgccttcatcaccagtctgtcttccattggcatc
gtggtcagtgatcctgactccacagatgcttcgagcgttgaagacaatgaggatgcttac
aacactgcatccctggagaactgtactggaaaatga

DBGET integrated database retrieval system