KEGG   Mus musculus (mouse): 23821
Entry
23821             CDS       T01002                                 

Gene name
Bace1, ASP2, Bace, C76936
Definition
(RefSeq) beta-site APP cleaving enzyme 1
  KO
K04521  beta-site APP-cleaving enzyme 1 (memapsin 2) [EC:3.4.23.46]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23821 (Bace1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    23821 (Bace1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.46  memapsin 2
     23821 (Bace1)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A1: pepsin family
   23821 (Bace1)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 23821
NCBI-ProteinID: NP_035922
MGI: 1346542
Ensembl: ENSMUSG00000032086
Vega: OTTMUSG00000034962
UniProt: P56818 Q8C4F4
Position
9; 9 A5.2
AA seq 501 aa
MAPALHWLLLWVGSGMLPAQGTHLGIRLPLRSGLAGPPLGLRLPRETDEESEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHIPNIFSLQLCGAGFPLNQTEALASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTADMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRHQHDDFADDISLLK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccccagcgctgcactggctcctgctatgggtgggctcgggaatgctgcctgcccag
ggaacccatctcggcatccggctgccccttcgcagcggcctggcagggccacccctgggc
ctgaggctgccccgggagaccgacgaggaatcggaggagcctggccggagaggcagcttt
gtggagatggtggacaacctgaggggaaagtccggccagggctactatgtggagatgacc
gtaggcagccccccacagacgctcaacatcctggtggacacgggcagtagtaactttgca
gtgggggctgccccacaccctttcctgcatcgctactaccagaggcagctgtccagcaca
tatcgagacctccgaaagggtgtgtatgtgccctacacccagggcaagtgggagggggaa
ctgggcaccgacctggtgagcatccctcatggccccaacgtcactgtgcgtgccaacatt
gctgccatcactgaatcggacaagttcttcatcaatggttccaactgggagggcatccta
gggctggcctatgctgagattgccaggcccgacgactctttggagcccttctttgactcc
ctggtgaagcagacccacattcccaacatcttttccctgcagctctgtggcgctggcttc
cccctcaaccagaccgaggcactggcctcggtgggagggagcatgatcattggtggtatc
gaccactcgctatacacgggcagtctctggtacacacccatccggcgggagtggtattat
gaagtgatcattgtacgtgtggaaatcaatggtcaagatctcaagatggactgcaaggag
tacaactacgacaagagcattgtggacagtgggaccaccaaccttcgcttgcccaagaaa
gtatttgaagctgccgtcaagtccatcaaggcagcctcctcgacggagaagttcccggat
ggcttttggctaggggagcagctggtgtgctggcaagcaggcacgaccccttggaacatt
ttcccagtcatttcactttacctcatgggtgaagtcaccaatcagtccttccgcatcacc
atccttcctcagcaatacctacggccggtggaggacgtggccacgtcccaagacgactgt
tacaagttcgctgtctcacagtcatccacgggcactgttatgggagccgtcatcatggaa
ggtttctatgtcgtcttcgatcgagcccgaaagcgaattggctttgctgtcagcgcttgc
catgtgcacgatgagttcaggacggcggcagtggaaggtccgtttgttacggcagacatg
gaagactgtggctacaacattccccagacagatgagtcaacacttatgaccatagcctat
gtcatggcggccatctgcgccctcttcatgttgccactctgcctcatggtatgtcagtgg
cgctgcctgcgttgcctgcgccaccagcacgatgactttgctgatgacatctccctgctc
aagtaa

KEGG   Mus musculus (mouse): 56175
Entry
56175             CDS       T01002                                 

Gene name
Bace2, 1110059C24Rik, A, AEPLC, AI850424, AL, ALP56, ARP1, AS, ASP1, ASP21, BAE, BAE2, CDA1, CDA13, CEA, CEAP1, DRAP
Definition
(RefSeq) beta-site APP-cleaving enzyme 2
  KO
K07747  beta-site APP-cleaving enzyme 2 (memapsin 1) [EC:3.4.23.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    56175 (Bace2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56175 (Bace2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.45  memapsin 1
     56175 (Bace2)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A1: pepsin family
   56175 (Bace2)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 56175
NCBI-ProteinID: NP_062390
MGI: 1860440
Ensembl: ENSMUSG00000040605
UniProt: Q9JL18 A0A0R4J0I8
Position
16; 16 C4
AA seq 514 aa
MGALLRALLLPVLAQWLLSAVPALAPAPFTLPLQVARATNHRASAVPGLGTPELPRADGL
ALALEPVRATANFLAMVDNLQGDSGRGYYLEMLIGTPPQKVQILVDTGSSNFAVAGAPHS
YIDTYFDSESSSTYHSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVNIATIFESE
NFFLPGIKWNGILGLAYAALAKPSSSLETFFDSLVAQAKIPDIFSMQMCGAGLPVAGSGT
NGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQNLNLDCREYNADKAIVDS
GTTLLRLPQKVFDAVVEAVARTSLIPEFSDGFWTGAQLACWTNSETPWAYFPKISIYLRD
ENASRSFRITILPQLYIQPMMGAGFNYECYRFGISSSTNALVIGATVMEGFYVVFDRAQR
RVGFAVSPCAEIEGTTVSEISGPFSTEDIASNCVPAQALNEPILWIVSYALMSVCGAILL
VLILLLLLPLHCRHAPRDPEVVNDESSLVRHRWK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggcgcgctgcttcgagcactcttgctcccggtgctggcgcagtggctcttgagtgcg
gtccccgcgctggcccccgcgcccttcacgctgcccctccaagtggcccgggccacgaac
cacagagcctcggctgttcccggactcgggacccccgagttgccccgggccgatggtctg
gccctcgcactggagcctgtcagggctactgccaacttcttggctatggtggacaacctt
cagggggactctggccgcggctactacctagagatgctgatcgggacccctccgcagaag
gtacagattcttgtggacactggaagcagtaacttcgctgtggcaggtgccccacactcc
tacatagacacctactttgactcagagagctccagcacataccactccaagggctttgat
gtcactgtgaagtacacacagggaagctggactggctttgttggtgaggaccttgtcacc
atcccaaaaggcttcaacagctctttcttggtcaatattgccactattttcgagtctgag
aatttctttttgcctggtattaaatggaatggaatccttggacttgcttatgctgctttg
gccaagccatcaagctctctggagacattttttgattccctggtggcccaagcaaagatt
ccagacattttctccatgcagatgtgcggggctggattgccagtagctggttctggtacc
aacggaggtagtcttgtcctgggtgggattgaaccaagtttgtataaaggagatatctgg
tataccccaattaaagaggaatggtactatcaaatagaaatcctgaagttggaaattgga
ggccagaacctcaacctggactgcagagagtataacgcagacaaggccattgtggacagt
ggcaccacgctcctgcgcctgccccagaaggtgtttgatgcagtggtggaagctgtggca
cgaacatctctgattccagagttttctgatggcttctggacaggggcccagctggcatgc
tggacaaattctgaaacgccatgggcatatttccctaagatttctatctacctgagagat
gagaatgccagtcgctccttccggatcaccattctcccacagctctacattcagcccatg
atgggagctggtttcaattatgaatgctaccgttttggtatctcctcttccacaaatgcg
ctggtgattggtgcgaccgtgatggaaggcttctacgtggtctttgacagagctcagagg
agggtgggctttgcagtgagtccctgtgcagagattgaaggtaccacagtgtctgaaatt
tctgggcccttttccacggaagacatagccagcaactgtgttccagcacaggctctgaat
gagcccatcttgtggattgtgtcctatgccctgatgagtgtgtgtggagccattctcctg
gttctgatcctcctcctgctgctcccgctgcactgccgtcatgccccccgagaccctgag
gtagttaacgatgagtcctcactagtcagacatcgctggaaatga

DBGET integrated database retrieval system