KEGG   Mus musculus (mouse): 238266
Entry
238266            CDS       T01002                                 

Symbol
Syt16, Stre, Strep14, Syt14l, syt1, syt14r
Name
(RefSeq) synaptotagmin XVI
  KO
K19328  synaptotagmin-14/16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    238266 (Syt16)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    238266 (Syt16)
SSDB
Motif
Pfam: C2 FAM176
Other DBs
NCBI-GeneID: 238266
NCBI-ProteinID: NP_766392
MGI: 2673872
Ensembl: ENSMUSG00000044912
UniProt: Q7TN83
Position
12; 12 C3
AA seq 549 aa
MATDITPEAIGFLSAIGVFVVLLAVLLLFINKKLCSENLRGHPYPEQRGKRKHSRDKTGG
HTGTVNSFGDDEEPSTSSESDEDVTKQFKISVSRSQSFRSGVSEKGKTTELEQKIKCKRL
LCTHQEDSAEGSACEGIHCSALHCRQGQVNDLDRTSQLSYSEILSYEDRPISILPQSPFE
SRNVRHHGPCRPEMGMVRSLGRPCADGVLETETAFVSRGFEDSYATHSSSLWSPEEQDGT
SLQVPHRLLEPISKCGDLDVIFEYRAVTQKLTVTIVRAQGLPDKDRSGVNSWQVHIVLLP
SKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCL
SHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDSASSTQSLSHGGVPELLVGLSYN
ATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKET
FVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQT
CRWHTLLES
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcgactgacatcactcctgaagccattggcttcctgtctgcaattggggtctttgtt
gtccttctggctgtccttctcctcttcatcaacaagaagctatgctctgaaaacctaaga
gggcatccatacccggagcaacgagggaagagaaagcactcgagagacaagactggaggc
cacacaggaactgttaacagctttggggatgatgaagagccatccacatcttctgagagt
gatgaagatgtgactaagcaattcaagatctcagtgtcccgatcccagagttttcgttca
ggagtatctgagaagggaaagacaacagagttggagcagaaaataaaatgcaaacgtttg
ctgtgtacccaccaggaagacagcgctgaagggtctgcttgtgaaggtattcattgcagt
gcattgcattgcaggcaagggcaggtcaatgatttggatcgaaccagccaacttagttat
tctgagattctgtcttatgaagaccgccccatttccattctcccacaatcccccttcgag
agcaggaacgtcaggcaccatggcccttgccgtccggagatgggcatggtccgaagcctc
ggtcgtccttgtgcagatggcgtcctggagacggagacagcttttgtgagtcggggcttt
gaagattcctatgccacccacagttcctctctgtggagtccagaggagcaggatggcacc
agtctgcaggtaccacacaggcttttggagcctatctcaaaatgcggtgacctcgatgtc
atctttgaatatagagctgtaacccagaagctcactgtgaccattgtgagagcacagggt
ctcccagataaggaccgaagtggtgtcaactcttggcaagttcacatagtgctgctgccc
agcaagaaacagaggggtaagacgaacatacagagagggcccaaccctgtcttcaaggaa
aaggtcaccttcaccaagctggagcccagagatgtggcttcctgtgctgtccgcttccgc
ctgtatgctgcccgtaagatgacccgggagagaatgatgggggagaagctgttctgtctc
agccacttgcacccagaaggggaaatgaaagtgactctggttctggagccaagaagtaat
ctgagcagtggagagtctccgctcagcccatctgtggtgtctcacagtgacagtgcttca
tccacgcagtcactgtctcatggaggggtgccagagctgctggtgggactgtcctacaat
gccacaacagggcgattatctgtggaaatgatcaaaggcagccatttccgcaacctcgct
gctaaccgagctcctgacacatatggaaaactcttcctcctcaactgtgtgggtcaagag
atgtcccgctgcaagacgtccattcgtcgtggccaacccaatcctgtctataaagagacc
tttgtcttccaggtggccctcttccagctctcggacgtcaccttgatgatttccatttac
agcaggcgcactatgaagcgtaaagagatgatcggctgggtcgctctgggccagaacagc
agtggggaggaggagcaggaacactgggaggaaatgaaggaaagcaagggccagcagacc
tgccggtggcatacgctgttggaatcctag

DBGET integrated database retrieval system