KEGG   Mus musculus (mouse): 238271
Entry
238271            CDS       T01002                                 

Gene name
Kcnh5, Eag2
Definition
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 5
  KO
K04908  potassium voltage-gated channel Eag-related subfamily H member 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    238271 (Kcnh5)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   238271 (Kcnh5)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 Cupin_2 Cupin_3 NPV_P10
Other DBs
NCBI-GeneID: 238271
NCBI-ProteinID: NP_766393
MGI: 3584508
Ensembl: ENSMUSG00000034402
UniProt: Q920E3
Position
12; 12 C3
AA seq 988 aa
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTETVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
EEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFANSF
SRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKNEVTLSIPVDHPVRKLFQKFKQQKELR
IQGSAQSDPERSQLQVESRPLQNGASITGTSVVTVSQITPIQTSLAYVKTSESLKQNNRD
AMELKPNGGAEPKCLKVNSPIRMKNGNGKGWLRLKNNMGAQEEKKEDWNNVTKAESMGLL
SEDPKGSDSENSVTKNPLRKTDSCDSGITKSDLRLDKAGEARSPLEHSPSQADVKHSFYP
IPEQALQTTLQEVKHELKEDIQLLSCRMTALEKQVAEILKLLSEKSVPQTSSPKPQIPLQ
VPPQIPCQDIFSVSRPESPESDKDEINF
NT seq 2967 nt   +upstreamnt  +downstreamnt
atgccggggggcaagagagggctggtggctccgcagaacacatttttggagaacatcgtc
aggcgctccagtgaatcaagtttcttactgggaaatgcccaaattgtggactggcctgta
gtttatagtaatgacggtttttgtaaactctctggatatcatcgagctgacgtcatgcag
aaaagcagcacctgcagttttatgtatggagaactgaccgacaagaagaccattgagaaa
gtcaggcagacttttgacaactacgagtcaaactgttttgaagttcttctgtacaaaaaa
aaccgtacccctgtttggttttacatgcaaatcgcaccaataagaaatgaacacgagaag
gtggtcttgttcctgtgtacattcaaggacattacactgttcaaacagcctatagaggat
gactcaacgaaaggttggacgaagtttgcccgattgacacgggctttgacaaatagccga
agtgttttacagcagcttacaccaatgaataaaacagagacagtccacaagcattcaaga
ctagctgaagtgcttcagctgggatcagacatccttcctcagtacaaacaagaagcgcca
aagacgccaccacatatcatcttacactattgtgcttttaaaactacttgggattgggtg
attttaattcttaccttctacaccgccatcatggttccttacaatgtttctttcaaaaca
aagcagaacaatatcgcctggctggtgctggacagtgtggtggacgtgatttttctggtg
gacattgttttaaattttcacacgacttttgtggggccgggtggagaggtcatttctgac
ccgaagcttataaggatgaactatctgaaaacttggtttgtgattgatctgctgtcttgt
ttaccttatgacatcatcaatgcctttgaaaatgtggatgagggaatcagcagtctcttc
agctctttaaaggtggtgcgccttttacgcctgggccgtgttgctaggaaactggaccat
tacctggaatatggagcagcggtccttgtgctcctggtatgtgtgtttggactggtggct
cactggctggcttgcatctggtacagcattggagactatgaggtcattgatgaagtcacc
aacaccattcaaatagacagctggctctaccagttggccttgagcattgggaccccatat
cgctacaatacgagtgcagggatctgggaaggaggacccagcaaggactccctgtatgtg
tcctccctctacttcaccatgacgagccttacaaccataggatttggaaacatagctccg
accacagacgtggagaagatgttctcagtggccatgatgatggtcggctctcttctttat
gcaactatttttggaaatgttaccacaattttccagcaaatgtatgccaacaccaaccgt
taccatgagatgctgaataatgttcgagatttcctgaaattatatcaggtcccaaaaggc
cttagtgaacgagtgatggattatattgtctcaacatggtcaatgtcaaaaggcatcgac
acagagaaggtcctctccatctgtcccaaggacatgagagctgacatctgtgttcatctg
aaccggaaggtttttaatgaacatcctgcattccgattggccagcgatggatgtctgcgt
gccttggcagtggagttccaaaccattcactgtgctcctggggacctgatttaccatgct
ggagagagtgtggatgccctctgctttgtggtgtccgggtccttggaagttatccaggat
gaggaggtggtggccattttagggaaaggtgacgtgtttggagacatcttctggaaggaa
accacccttgctcatgcgtgtgccaatgtccgggccctgacttactgtgatctgcacatc
atcaagcgagaagccttgctcaaggtccttgacttctatacagcatttgcaaactcattt
tccaggaacctcactctcacttgcaatctaaggaagcggatcatcttccgtaaaattagt
gatgtgaagaaggaggaggaggagcggctgcggcagaagaatgaggtgactctgagcatc
cccgtggaccacccagtgaggaagctcttccagaagttcaaacagcagaaagaactgagg
atccagggctctgcacagagtgatcctgagaggagccagcttcaggtagagagccgccct
ttgcagaacggagcctccatcacaggtaccagtgtggtcaccgtatcacagattaccccc
atccagacgtctctggcgtatgtgaaaaccagcgagtctcttaagcagaacaaccgcgat
gccatggaactgaagcccaatggtggcgctgaacccaaatgtctcaaggtcaacagcccc
atcaggatgaaaaacggaaatgggaaggggtggctgagactcaagaacaacatgggggct
caggaggagaaaaaggaagactggaataatgtcaccaaagccgagtcgatggggctcttg
tcggaggaccccaagggcagtgactcagagaacagtgtgaccaagaaccccttaaggaaa
acggattcttgtgacagtgggattacaaaaagtgaccttcgtttggataaagccggtgag
gcccgaagtcctctagaacacagccccagccaggctgatgtcaagcattctttctacccc
atccccgagcaggccttacaaaccacactgcaggaagtcaaacatgaactcaaggaggat
atccagctgctaagctgcagaatgactgccctggaaaagcaggtggcagagattttaaaa
ctactctcagagaaaagcgtaccccagacatcttctccaaaaccccaaattccactccaa
gtacctccccaaataccatgtcaggatatttttagtgtctcaaggcctgagtcacccgaa
tctgacaaagacgaaatcaacttttaa

DBGET integrated database retrieval system