KEGG   Mus musculus (mouse): 238276Help
Entry
238276            CDS       T01002                                 

Gene name
Akap5, 3526401B18Rik, AKAP_150, AKAP-5, AKAP150, BB098886, Gm258, P150
Definition
(RefSeq) A kinase (PRKA) anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:mmu01009]
    238276 (Akap5)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     238276 (Akap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WSK
Motif
Other DBs
NCBI-GeneID: 238276
NCBI-ProteinID: NP_001094941
MGI: 2685104
Ensembl: ENSMUSG00000021057
Vega: OTTMUSG00000016317
UniProt: D3YVF0
Position
12; 12 C3
AA seq 745 aa AA seqDB search
METSVSEIQVETKDEKGPVAASPQKERQERKTATLCFKRRKKANKTKPKAGSRTAEETKK
HTPEAGGSGQRQPAGAWASIKGLVTHRKRSEPAKKQKPPEAEVQPEDGALPKKKAKSRLK
FPCLRFSRGAKRSRHSKLTEDSGYVRVQGEADDLEIKAQTQPDDQAIQAGSTQGLQEGVL
VRDGKKSQESHISNSVTSGENVIAIELELENKSSAIQMGTPELEKETKVITEKPSVQTQR
ASLLESSAAGSPRSVTSAAPPSPATTHQHSLEEPSNGIRESAPSGKDDRRKTAAEEKKSG
ETALGQAEEAAVGQADKRALSQAGEATAGHPEEATVIQAESQAKEGKLSQAEETTVAQAK
ETVLSQAKEGELSQAKKATVGQAEEATIDHTEKVTVDQAEETTVGQAEEATVGQAGEAIL
SQAKEATVVGQAEEATVDRAEEATVGQAEEATVGHTEKVTVDQAEEATVGQAEEATVGQA
EEATVDWAEKPTVGQAEEATVGQAEEATVGHTEKVTVDQAEEATVGQAEEATVGHTEKVT
VDHAEEATVGQAEEATVGQAEKVTVDHAEEATVGQAEEATVGQAEKVTVDHAEEATVGQA
EEATVGQAEKVTVDQAEEPTVDQAEEAISSHAPDLKENGIDTEKPRSEESKRMEPIAIII
TDTEISEFDVKKSKNVPKQFLISMENEQVGVFANDSDFEGRTSEQYETLLIETASSLVKN
AIELSVEQLVNEMVSEDNQINTLFQ
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcgtttctgagattcaggtagagacgaaggacgagaagggaccagtagca
gccagtcctcagaaagagaggcaggagagaaaaacagccacactctgcttcaagagaagg
aagaaagcgaacaagacaaaacccaaagccggttccaggactgctgaggagacaaagaaa
catacccccgaagctgggggctctggtcaacggcaaccagcgggtgcctgggcctccatc
aaaggccttgtgacacacaggaaaaggtccgagcctgcaaagaagcagaagccgcctgag
gcagaggtgcagcccgaggatggggctcttcctaagaaaaaggcaaaatccagacttaag
tttccttgcctaagattctcaagaggggcaaagagaagtcgtcattccaaactcacagaa
gattcaggctacgtcagagtccagggagaggcagacgatttggagataaaagcccagacc
cagccagatgaccaggcaatccaggctgggtctacccagggcctacaggaaggtgtgttg
gtgagagatggtaagaagagccaagaatcacacataagcaacagcgtcacctcgggagag
aatgtgatcgccatagaactggaattagaaaacaaatcttctgctatccagatgggaact
cctgagctggaaaaggagactaaggtgatcacggaaaagccaagtgtgcagacgcagcga
gcaagtctacttgagagttcagcagcaggcagccctcggtcagtgacttctgctgctcct
ccatcaccagcaaccacacatcaacatagtctggaagaacccagtaatggcatccgggaa
agtgccccaagtgggaaagatgacaggagaaagactgctgctgaagaaaagaaatcagga
gagactgcactgggccaggcagaggaagctgcagttggccaggcagacaaaagggcacta
agccaggccggagaagctacagcgggccacccagaggaagctactgtgatccaggcagag
agtcaggcaaaggaagggaaactgagccaggcagaggaaactacagtggcccaggcaaag
gaaactgtattgagtcaggcaaaggaaggtgaactgagccaggcaaagaaagctacagtt
ggccaggcagaggaagctacaattgaccacacagagaaagtcacagtggatcaggcagag
gaaaccacagtgggtcaggcagaagaagctacagttggtcaggcaggggaagctatattg
agccaagcaaaggaagctacagttgttggtcaggcagaggaagctacagttgatcgggca
gaggaagctactgttggtcaggcagaggaagctacagttggccacacagagaaagtcaca
gtggatcaggcagaggaagccacggtgggtcaggcagaggaagctactgttggtcaggca
gaggaagctacagttgattgggcagaaaaacccacagttggtcaggcagaggaagccaca
gtgggtcaggcagaggaagctacagttggccacacagagaaagtcacagtggatcaggca
gaggaagcaacagtgggtcaggcagaggaagctacagttggccacacagagaaagtcaca
gtggatcatgcagaggaagccacagtgggtcaggcagaggaagctacagttggacaggca
gagaaagtcacagtggatcatgcagaggaagccacagtgggtcaggcagaggaagctaca
gttggacaggcagagaaagtcacagtggatcatgcagaggaagccacagtgggtcaggca
gaggaagctacagttggacaggcagagaaagtcacagtggatcaggcagaggaacccaca
gtggatcaggctgaggaagctatatcgagccatgcaccagatctgaaagaaaatggaatt
gatacagagaaaccgagatcagaagaaagcaaacgaatggagccaattgctattatcatt
actgacactgaaatcagtgaatttgatgttaagaagtctaaaaatgttcctaagcaattc
ctaatttcaatggaaaacgagcaagtgggggtttttgctaatgatagtgatttcgagggg
agaacttcagaacagtatgaaacactcttaatagaaacagcatcttctctcgtcaagaat
gctatcgagttgtctgtagaacagctggttaatgaaatggtttccgaggataatcaaata
aatacgctgttccagtga

DBGET integrated database retrieval system