KEGG   Mus musculus (mouse): 23828
Entry
23828             CDS       T01002                                 

Gene name
Bves, Pop, Pop1, Popdc1, mBVES
Definition
(RefSeq) blood vessel epicardial substance
  KO
K21108  blood vessel epicardial substance
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23828 (Bves)
SSDB
Motif
Pfam: Popeye cNMP_binding
Other DBs
NCBI-GeneID: 23828
NCBI-ProteinID: NP_077247
MGI: 1346013
Ensembl: ENSMUSG00000071317
Vega: OTTMUSG00000063720
UniProt: Q9ES83
Position
10 B2; 10 23.47 cM
AA seq 358 aa
MNSTESIPLAQSTVAGFTSELESLTPVPSNETTCENWREIHHLVFHVANVCFAVGLLIPT
TLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSVFLGINILHLSYLLYKKRPVKI
EKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQVYATEDKTSVDDRLSILLKGR
MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE
SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLCTQISMLEMRNSITSSS
DGEDGLHHFLRGSSSTASLPMSSPQQRASAKMKPIEEGVEDDDEVFVSPDALKVHQLP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaattccacggagtccatcccgctggcacagtcaactgtagcaggttttacatctgag
ttagaaagtctcacacccgtgccttctaatgagaccacttgtgagaactggcgagagatt
caccatctggtttttcatgtagcaaacgtttgctttgcagttggtttgctaattcccacc
actcttcacctccatatgatactgctcagagtgatgttgtctctaggatgtaccctttat
gtggtctgggccactctctaccgctgtgccttggatgtgatgatctggaactcggtgttc
ttgggtatcaatattttgcatctttcatatcttttgtacaagaaaagaccggtcaaaatt
gaaaaggagctgggtggtgtctaccatcggttgtttgaaccactccgagtccctccggat
ttgtttagaaggttaaccggacagttttgtatgatccagaccttgaaaaggggccaggtt
tacgccacagaggacaaaacctcagttgatgatcgtcttagtattctcctaaaaggaaga
atgaaggtctcctatcgaggacattttctgcataacatttacccgtgtgcctttatagat
tctcccgaattcagatcaacgcagatgcacaaaggcgaaaaattccaggtcaccattgtt
gcagatgataactgcaggttcttatgctggtcaagagaaagactgacttactttctggag
tcagagccttttctgtatgaaatttttaggtaccttataggaaaagacattacaaataag
ctgtactcactgaatgaccctactttaaatgataagaaagttaagaagctggagccccag
atgagcctctgcacacagatctccatgctggagatgaggaacagtatcaccagctccagc
gacggcgaggacggcctgcaccactttctgcggggctcctccagcacggcgtctctcccc
atgtcctccccgcagcagcgagcctctgccaagatgaagccaatcgaggaaggggtagaa
gatgacgatgaggtctttgtgtctccagacgcactcaaagtccatcagttgccttga

DBGET integrated database retrieval system