KEGG   Mus musculus (mouse): 23830Help
Entry
23830             CDS       T01002                                 

Gene name
Capn10, AW049679, Capn8, mKIAA1845
Definition
(RefSeq) calpain 10
  KO
K08579  calpain-10 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    23830 (Capn10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     23830 (Capn10)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C2: calpain family
   23830 (Capn10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III
Motif
Other DBs
NCBI-GeneID: 23830
NCBI-ProteinID: NP_035926
MGI: 1344392
Ensembl: ENSMUSG00000026270
Vega: OTTMUSG00000026368
UniProt: Q9ESK3
Position
1; 1 D
AA seq 666 aa AA seqDB search
MRAVRAETPARELFRDAAFPASDSSLFYNLSTPLAQFREDITWRRPQEICATPQLFPDNP
WEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQKYQGFFTCRIWQFGHWE
EVTIDDRLPCLAGRLCFSRCQREDVFWLPLLEKAYAKVHGSYEHLWAGQVADALVDLTGS
LAERWSLKDVTKASGQQDRPSGGEHRTCRQLLHLKDRCLISCSVLSPRAGARELGEFHAF
IISDLQELRSQTGQGILLLRIHNPWGRRCWQGLWREGGEGWNQVEPAKESELLAQLQEGE
FWVEEEEFLREFDEVTIGYPVTEAGHLQSLHTERVLCHTRTLPGAWVTGQSAGGCRNNSC
FPCNPKFWLRLLEPSEVCVAVLQRPRRRLVGQTRALAGASPAPVNLPGKDYQAVGLHIWK
VEKRKISLPRVLSAPPVAGTACHAYDREIHLRCELSPGYYLAVPSTFLKDVPGQFLLRVF
STGKISLSAVRLATKGASPGTALPAGEWETVQLQGCWRAGQTAGGSRNFASYPCNPCLPF
SVPEGAGPRYIRITLQQHCRLSDSQLHPIGFHVFQVPADGENQDACSLLLQEPLLSCVPH
RYAQEVSRLCLLSVGNYRIVPSTYLPDTEGTFTVTIATRIDRQSIHSQEMLGQLLQEVSF
MAVMKA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcggtccgggccgagacgccggcgcgggagctcttccgggacgcggcattcccc
gcctcggactcctcgctcttttacaacttgtccacgcctctggcccagtttcgggaggac
atcacttggagacgaccccaggaaatctgtgccacacctcagctgtttccagataaccca
tgggagggacaggtgaagcaagggctgctgggagattgctggttcctgtgtgcctgtgcc
gcccttcagaagagtcaacacctcctggaccaggtcttccctccaggacagccaggctgg
tctgaccagaaataccaaggcttcttcacctgtcggatttggcagtttggacactgggag
gaagtgaccatagatgatcgtctgccttgtcttgccgggagactctgcttttcccggtgc
cagagagaggatgtgttctggcttcccttactggaaaaggcctatgctaaggtccatgga
tcgtatgagcacctgtgggcagggcaagtggcagatgccttagtggatctcactggaagc
ctggcagaaaggtggagcttgaaggatgtaacgaaagccagcggccagcaggacagaccc
agtggtggggagcacagaacttgtcggcagctactccacctgaaggaccggtgtctaatc
agctgctctgtgcttagccccagagcaggtgccagggaactcggagagttccatgccttc
atcatctcagatctgcaggagctcaggagtcagactggccagggtatcctcctgctgcgg
attcacaacccctggggccggcgttgttggcagggcctctggagagaaggaggtgaaggg
tggaaccaggtagagccagctaaggagtctgagctgctggcccaactccaggaaggagag
ttctgggtcgaggaagaggagttcctcagggagtttgatgaggtcaccatcggctaccca
gtcacagaggccggccacctacagagtctccacacagagagggtgctgtgccatacgcgg
acactgcctggtgcctgggtgacagggcagtcagcaggaggctgccggaacaacagttgc
tttccctgcaaccccaagttctggttacggctcttggaacccagcgaggtgtgtgtggct
gttcttcagagaccccggaggcgcttagtgggccagactcgggcactggcgggtgccagt
cctgcaccggtgaacctcccaggcaaagactaccaggctgtgggcctgcacatctggaag
gtagagaaacggaagatcagcctgcccagagtcctgtctgcaccccctgtggctggcact
gcatgccatgcgtatgatcgtgagatccacttgcgttgtgagctctcaccaggctactac
ctggccgtccctagcacctttttgaaggatgtgccagggcagttcctgctcagagtcttc
tccactgggaaaatctccctcagtgccgtcaggctggccaccaagggtgcatcgcctgga
acagccctgcctgcaggcgagtgggagactgtgcagttgcagggctgctggagagctggc
cagacagctgggggcagcaggaactttgcctcttacccctgcaatccctgcctccctttc
tctgttcctgagggtgctggcccccgctacatccgtatcaccctacagcaacactgccgg
ctcagtgacagccagctgcaccccattggtttccatgtctttcaggttccagcagacggt
gagaaccaggacgcgtgttccctgctgctccaggagccactgctaagctgtgtaccacat
cgctacgcccaggaagtgagccgcctctgcctcctttctgtggggaactacaggattgtt
ccctccacctacctgccagatacagagggtaccttcacggtaaccatagcaaccagaatc
gataggcagtccatccacagccaggagatgctgggccagctgctccaggaggtctccttt
atggcagtgatgaaagcctga

DBGET integrated database retrieval system