KEGG   Mus musculus (mouse): 23833
Entry
23833             CDS       T01002                                 

Gene name
Cd52, AI463198, B7, B7-Ag, CAMPATH-1, CLS1, MB7
Definition
(RefSeq) CD52 antigen
  KO
K06488  CDW52 antigen
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    23833 (Cd52)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    23833 (Cd52)
CD molecules [BR:mmu04090]
 Proteins
  23833 (Cd52)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  23833 (Cd52)
SSDB
Motif
Pfam: CD52 TarH ODV-E18 Defensin_propep ILVD_EDD Cadherin_C_2
Other DBs
NCBI-GeneID: 23833
NCBI-ProteinID: NP_038734
MGI: 1346088
Ensembl: ENSMUSG00000000682
Vega: OTTMUSG00000010233
UniProt: Q64389 Q3U1T8
Position
4 D3; 4 66.5 cM
AA seq 74 aa
MKSFLLFLTIILLVVIQIQTGSLGQATTAASGTNKNSTSTKKTPLKSGASSIIDAGACSF
LFFANTLMCLFYLS
NT seq 225 nt   +upstreamnt  +downstreamnt
atgaagagcttcctcctcttcctcactatcattcttctggttgtgattcagatacaaaca
ggatccttgggacaagccactacggccgcttctggtactaacaaaaacagcacctccacc
aaaaaaacccccttaaagagtggggcctcatccatcatcgatgcgggtgcctgcagtttc
ctcttctttgccaataccttaatgtgcctcttctacctcagctga

DBGET integrated database retrieval system