KEGG   Mus musculus (mouse): 238405Help
Entry
238405            CDS       T01002                                 

Gene name
Adam6b, 4930523C11Rik
Definition
(RefSeq) a disintegrin and metallopeptidase domain 6B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_CR Disintegrin Pep_M12B_propep Reprolysin
Motif
Other DBs
NCBI-GeneID: 238405
NCBI-ProteinID: NP_001009545
MGI: 2444636
Ensembl: ENSMUSG00000051804
Vega: OTTMUSG00000051587
UniProt: Q6IMH7
Position
12; 12 F1
AA seq 756 aa AA seqDB search
MLSLTWGMRLVERPVVPRVLLLLFALWLLLLVPVWCSQGHPTWRYISSEVVIPRKEIYHT
KGLQAQRLLSYSLHFRGQRHIIHLRRKTLIWPRHLLLTTQDDQGALQMDYPFFPVDCYYI
GYLEGIPQSMVTVDTCYGGLSGVMKLDDLTYEIKPLNDSQSFEHLVSQIVSESDDTGPMN
AWKHWSHNTGSPSSRLEYADGAPRISSKNYATHPAAIKGHFQATNSVYNSAAGDKLSSTV
GYLFQVISLMDTYLTNLHMRYYVFLMTVYTNSDPFRLEFAVPGGSAYNYYVSVFYNKFKP
DAGVLLNKYGPQDNQVNPAERSICSSLALICIGKYDRNPLFLSPIITNRVGRSLGLKYDE
GYCVCQRRNTCIMFRHPQLTDAFSNCSLAEISNILNTPGLMPCLFYDRHVYYNTSLTYKF
CGNFKVDNDEQCDCGSQKACYSDPCCGNDCRLTPGSICDKELCCANCTYSPSGTLCRPIQ
NICDLPEYCNGTKYICPDDTYLQDGTPCSEDGYCYKGNCTDRNIQCMEIFGVSAKNANIK
CYDINKQRFRFGHCTRAEESLTFNACADQDKLCGRLQCTNVTNLPYLQEHVSFHQSIISG
FTCFGLDEHRGTETTDAGMVRHGTPCSKSKFCDQGACSGSLSHLGYDCTPEKCSFRGVCN
NHRNCHCHFGWKPPECKEEGLSGSIDSGSPPVQRHTIKQKQEPVVYLRILFGRIYFLFVA
LLFGIATRVGVTKIFRFEDLQATLRSGQGPARDKPK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgttatctctgacctggggcatgaggctagtggaaagacctgtggtccccagggtcctc
ctcttgctatttgcactctggctgctcctcctggttccagtctggtgttctcaaggccat
cctacttggcgttacatctcatcggaggtggttattcctcggaaggagatctaccatacc
aaaggacttcaagcacaaagactgctctcatatagcttgcattttcggggccagagacat
atcatccacctgcggagaaagacactcatttggcccagacacttgttgctgacaactcaa
gatgaccaaggagccttacagatggattaccccttttttcctgtagattgttactatatt
ggctacctggaggggatcccacaatccatggtcactgtggatacttgttatgggggcctg
tcaggggtcatgaagttagatgaccttacctatgaaatcaaacccctcaatgattcacag
agctttgaacaccttgtttctcagatagtatctgagtctgatgacacagggcctatgaat
gcatggaagcactggagccataatacaggttctccctcctccagattggaatatgcagat
ggagctcccagaatatctagtaagaactacgctacacatccagctgctataaaaggccac
tttcaagcaaccaattctgtatataattctgctgcaggtgacaaactttcatctactgtt
gggtatttgtttcaagtcattagtttaatggacacctatctgaccaatcttcatatgcgg
tactatgtctttctcatgactgtgtacaccaattctgatccatttcgacttgagtttgca
gttccaggagggtcggcttataattactatgtgtcagtcttttataataaatttaagcct
gatgcaggagttttacttaataagtatgggccacaagataaccaggttaatccagctgag
aggagtatatgttcttccttagccctaatttgtattggtaaatatgatcgaaatccttta
tttttatctcctataataaccaatcgtgttggaaggagtttaggcttaaaatatgatgag
gggtactgtgtctgccagagaaggaacacctgcattatgttcagacatcctcaattaaca
gatgctttcagcaattgttcccttgcagagataagcaacatacttaatactcctggtctg
atgccatgtcttttctatgaccgtcatgtttattataatacatcattgacttataagttt
tgtggaaacttcaaagtagataacgatgagcagtgtgactgtggctcccaaaaggcatgt
tattcagatccctgctgtggaaatgattgcaggttaacacctggtagcatttgtgataaa
gaattatgctgtgcaaattgcacttacagtccttctgggacactctgcagacctatccag
aacatatgtgatcttccagagtactgtaatgggactaaatacatttgcccagatgacact
tatctgcaagatgggacaccatgctcagaagatggttactgctataaaggtaactgcact
gatcgcaacatacaatgcatggaaatctttggtgtaagtgctaagaatgctaatattaag
tgctatgacatcaacaaacaacggtttcgatttgggcattgtactagagcagaagaaagc
ctcacattcaatgcttgtgctgatcaggacaagctgtgtggaaggttgcagtgtaccaat
gtcaccaatcttccatatttgcaagaacatgtttcattccatcaatcgattatctctggg
tttacctgctttgggcttgatgaacatcgtgggacagaaacaacagatgctggaatggtg
agacatggtaccccctgctccaaaagtaagttctgtgatcaaggagcttgcagtggaagt
ttatctcatttgggttatgactgcaccccagaaaaatgcagttttagaggagtgtgtaac
aatcatcggaattgccattgtcattttggttggaagcctccagagtgcaaagaagaggga
ctaagtgggagcatagacagtgggtcccctccagttcaaaggcacacaataaaacaaaaa
caagagccagtggtgtatttaagaatactctttggtcgtatttacttcctctttgttgca
ctgctctttggcattgccactcgtgtaggagttactaagatttttagatttgaagacttg
caagctactttacgttctgggcaaggaccagcaagggacaagccaaagtaa

DBGET integrated database retrieval system