KEGG   Mus musculus (mouse): 23850
Entry
23850             CDS       T01002                                 

Gene name
Pappa2, PAPP-A2, PLAC3, Pappe
Definition
(RefSeq) pappalysin 2
  KO
K08647  pappalysin-2 [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    23850 (Pappa2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     23850 (Pappa2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M43: cytophagalysin family
   23850 (Pappa2)
SSDB
Motif
Pfam: Laminin_G_3 Peptidase_M43 Sushi Notch Laminin_G_2 Reprolysin_3 DUF4953 Peptidase_M10 Laminin_G_1 Peptidase_M66
Other DBs
NCBI-GeneID: 23850
NCBI-ProteinID: NP_001078845
MGI: 3051647
Ensembl: ENSMUSG00000073530
Vega: OTTMUSG00000029804
UniProt: E9PZ87 Q8BJG6 Q505G3
Position
1; 1 H1
AA seq 1789 aa
MMCWKVLRISLVVLTGWALSTTNSEQGWTRKKFLAQKEHLNQVLLEGERCWLGYKVRRPR
TAPQHHLFGVYPSRLENYPRSYPVGTQQQTLYAEWSQRSPERQAPSGIPRDLTENPAGAR
RESQQPAAPWVGDGPIGQSQLLRNDDTYLGEGGSKEALGEPAIQGSSEIAVSTIATFAYQ
KGPTAETQRKGQSKSRLPRQVQKRQAEDMTGDPQNTPQGFQLWPKEPLKHGDSDSPLEGT
IQNGGGASLRRVETFNSQGGLPVLYFTGKRERLLLRPEVLAEIPREAFTVEAWVRPEGGQ
SNPAIIAGVFDNCSHTVNDKGWALGIRSGKDKGWRDARFFFSLRTDRMKKATIVTGHSRY
QPGMWTHVAATYDGQHTALYVDGTRVASSRDQFGPLNSPFMASCRSLILGGDSSEDGHYF
RGYLGTLVIWSTALSQTHLQHSPLHPSAADELTTLILTATFDPLMEQWAPFRDDLYPRLE
VLQDSESQPEILSPLQPPPCGQTACDNVELISQYNKHGPLRREKVIRYQVVNIYDDEGLH
PIVSDHQIRRQHEALNQAFSRYNISWQLSVHRVHNSTLRHRVVLVNCEPSKIGNDHCDPE
CEHPLTGFDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVTDVRKTCFDP
DSPKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGSATWPWDKEALSHLGGVVLNP
TYYGMLGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPK
SKLCRDPEPANDTCGFTLFPGAPFNNYMSYTDDECTDNFTPNQVARMHCYLDLVYQQWSE
SQKPTPIPIPPMVIGQTHKSLTIHWLPPISGVVYDRAPDSMCSACTEDGTFRQYVYKASS
GRVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLNHMNMTVPCPAEGCSLELLFQY
PVQADTLTLWVTYLSMNSSKAFFDIEILLEHKKSMHLGPLNTFCDIPLTIKLHMDEKVMG
AKVYTFDERMEIDAALLTSRPNSSLCSGCKPMSYQVLREPPFSSGLPMVVTHPHRKFTDT
EVIPGQMYQYQVQAEAVGELGEASPPLSHIHGGPYCGDGKVERSIGEMCDDGDLLNGDGC
SRACELEEGFNCAGEPSLCYRYEGDGVCEDFEKESIITDCGLHTPEGYLDQWASQAYSYH
EDKEKCPVSLVTGEPHSMICTSWHPDSSPYHSFPGWFPCVFSLKKDQDAGSEQAKDSLQK
DNEIWLEVCFNRPGVAVAIYIFLASDGVTPGEHQQATVTLYLIDVSGSNHSLGTYGLSCQ
QNPLVINVSHHVNVYPQHTSSMLLNFSSPLVGISAVALRTSSQTSSSAPSNCIPEQNYEG
KSCAQRPCGEQGRCAPLLLDHTDMVNCTSSSPGHMECAITCQRGYVLQTSSGQYLRNMQK
EILLTCSSGHWDKDVICKRLDCGVPDSSLVNYANFSCLEGTDFLKQCSISCVPPAKLQGL
NPWLTCLEDGLWSLPEVYCKLECEAPPVIPNANLLLPHFLEGNHDVGTICKYECKPGYYV
KETSGSQGKNKFLKIQCLDDGSWEQGSCVPVVCEPPPPVFEGMYECTDGFKLDSQCVLNC
NQETEGIPILCTKEGLWTQEFKLCENLQGECPPPTSELNSVEYKCGQGYGIGAVCSPSCV
IPPSDPVILPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPSLVHCIQSCEPFQADGWC
DTINNRAYCNYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
NT seq 5370 nt   +upstreamnt  +downstreamnt
atgatgtgttggaaggtcctgagaataagcctggtggtcctgactgggtgggcactcagt
accaccaactcagagcagggctggacacgcaagaaattcctggcccagaaggaacacctg
aaccaagtgctgttggaaggggaacgctgttggctggggtataaggttcgaagacccagg
actgctccacagcaccatctctttggggtctacccaagccgcctcgaaaactacccaagg
tcctatcctgtggggacacagcagcaaaccctgtatgcagaatggagtcagcgaagccca
gagagacaggctccgagtggtattccccgagacctgactgaaaacccagcaggagcaagg
agagagtctcagcagccagctgccccgtgggtaggggatggtcctattgggcaatcgcag
ctgctgagaaatgatgacacttatcttggcgagggaggatctaaggaggctctaggtgag
cctgcgattcagggaagctcagaaattgctgtctccaccattgctaccttcgcatatcag
aagggacccacagcagagacccagaggaagggccagtccaagtctaggcttcctcgccaa
gtgcagaagaggcaggcagaagacatgactggagacccccagaatacccctcaaggtttc
cagctttggcctaaagagccacttaagcatggagatagtgacagtccattggagggcacc
atccaaaatggtggaggggcctctctccggagagtagagacctttaactcccaaggagga
ttgcctgtactgtatttcactgggaagagggagcggctgttgctgcgtccagaagtgctg
gctgagattccccgggaggcgttcacagtggaagcctgggtgagaccagagggaggacag
agcaacccagccatcattgcaggtgtgtttgataactgctcccacacagtcaatgacaag
ggctgggccctggggatccgctcagggaaggacaaggggtggagagatgctcgcttcttc
ttttccctccgcactgaccggatgaagaaagccactattgtgactggccacagccgttac
cagccaggcatgtggactcatgtagcagccacttacgatggacagcatacagctctgtat
gtggatggcactcgagtggctagtagtcgtgaccagtttggaccgctaaatagccctttc
atggcgtcttgccgctctttaatcctgggaggggacagctccgaggatggacattatttc
cgtggttacctgggcacactggtaatctggtcgaccgccctttcacaaacccacctccag
cacagtcccctgcatccaagtgcagcagatgagttgaccaccctgatcctgacagccact
ttcgatcctctgatggaacagtgggctccatttagagatgacttatatccccggctggag
gttctccaggactctgagtcacagcctgagattctgtcacctttacaacccccaccttgt
gggcaaacagcttgtgacaatgtggaactcatctcccagtacaataagcatgggcccctt
cgtagagagaaagtgatccgctaccaggtggtaaacatctatgatgatgagggtctgcat
cccattgtgagtgatcatcagatccgccgtcagcatgaggccctcaaccaggccttcagc
cgctacaatatcagctggcagctgagtgtccaccgagtccacaactccaccctgcgccac
cgggttgtgcttgttaattgtgagcccagcaagattggcaatgaccactgtgaccctgaa
tgtgagcatccactcaccggcttcgatgggggcgattgccgcctgcagggacgctgctac
tcctggaatcgcagggatggcctctgtcacgtggagtgcaacaacatgctgaatgacttc
gatgatggagactgctgcgatccggaagtgactgatgtccgaaagacttgctttgatcct
gactcacccaagagggcatacatgagtgtgaaggaactaaaggaggccttgcagctcaac
agcactcacttccttaatgtctacttcgccagctcagtccgggaagaccttgcaggttct
gccacatggccctgggacaaggaagctctcagtcacctgggtggtgttgtcctcaaccca
acctattatggcatgcttggccacaccaacatcatgatccatgaggtgggacatgtcctg
ggactctaccatgtattcaaaggagtcagtgaaagagaatcctgtgatgatccctgtaga
gagacagtgccatccatggagacaggagacctgtgtgctgacactgctcccacacccaag
agcaagctgtgtcgggacccagagccagctaatgacacctgtggcttcaccctcttccca
ggggctccgttcaataactacatgagctacacagatgatgagtgcactgacaacttcacc
cctaaccaagtggcccggatgcattgctacttggacctcgtataccagcaatggagtgaa
agccaaaaacctacccccatacccataccacccatggttattgggcaaacccacaagtcc
cttactatccattggctgcctccaatcagtggagttgtgtatgatagggcccctgacagc
atgtgtagtgcctgcactgaagatgggacattccgtcagtatgtatacaaggcatcctct
gggcgggtgtgtgactcttcaggttactggactccagaggaggctgtggggcctcctgat
gtcgatcaaccctgtgagcctagcttgcaggcctggagtcctgagctccacctaaaccac
atgaatatgaccgtgccctgcccagcagaaggctgtagcttggagttgctttttcaatac
ccggtccaggcggataccctcaccctctgggtcacttacctctccatgaactcttccaag
gcattctttgacatagagatcttgctagaacacaaaaaatctatgcaccttggaccttta
aacactttttgtgacataccgctcaccatcaaactccacatggatgagaaggtcatggga
gcgaaagtctacacctttgatgaacgaatggaaattgatgctgctctcctgacctctcgg
cccaatagttccttgtgttctggatgcaagcctatgagttaccaggttcttcgagagcct
cctttttccagtggcttgcccatggtggtgacacatccacacagaaagttcacagatacg
gaggtcatccctgggcagatgtatcagtaccaagttcaagctgaagctgtaggggaactc
ggagaagcttcacctcctctgagccacattcacggaggcccttactgtggagatgggaag
gtagaaaggagtatcggagagatgtgtgatgatggagacctgttgaatggagatgggtgc
tcaagagcatgtgaactggaggaaggcttcaattgtgcaggggagccaagcctttgctac
aggtatgagggagatggggtttgtgaagattttgagaaggaaagcatcatcacagactgt
ggcctccacactcctgaaggatatttggatcagtgggctagccaggcttattcctaccat
gaagacaaggagaaatgtcctgtttccctggtaacaggagaacctcattcaatgatctgt
acttcatggcacccggattcatccccatatcattcctttcctggctggtttccctgtgtc
ttcagtctgaagaaagaccaggatgcaggcagtgagcaggctaaagatagcctgcagaag
gacaatgaaatttggcttgaagtgtgtttcaataggccaggggttgcagtggcaatttac
attttcttggcatcggatggcgtgacccctggggagcatcagcaggcaacagtgaccctt
tacctgattgatgtcagtggaagcaaccactctcttggaacctatggactgtcgtgtcaa
caaaatccactggttatcaatgtgagccatcatgtgaatgtctacccccaacatacctcc
tccatgctgctgaatttttcatccccactggtgggcatctcagcagtggctctaaggaca
tcctcccagaccagttcttcagctcccagtaactgcatcccagagcaaaattatgaggga
aagagctgtgctcaacgaccttgtggagaacagggaagatgtgcgccattgctactcgat
catacggacatggtgaattgtacctccagtagcccaggtcacatggagtgcgctatcact
tgtcaaagggggtatgtccttcagaccagcagtgggcagtacctgaggaacatgcagaaa
gagattctccttacttgttcctctggccactgggacaaggatgtgatctgcaagcgtctt
gactgtggtgtcccagactcctccttggtgaattatgcaaacttctcctgcttggagggt
acagactttctgaaacaatgttccatctcgtgtgtcccaccggctaagctccaaggactg
aacccatggctgacatgtcttgaagatggactctggtctctccctgaagtctactgcaag
ttggaatgtgaagctcctccagttattcccaatgccaatctgctcctgccacatttcctg
gaaggcaaccatgatgtgggcaccatctgcaaatatgagtgcaaaccaggctactatgtg
aaggagacttcaggaagtcaaggcaagaacaagttcctgaagatccagtgcctggatgat
ggaagctgggaacaagggagctgcgtccccgtggtttgtgagcctcctcctccggtgttt
gaaggcatgtacgaatgtactgatggcttcaagctggacagccagtgtgtgctcaactgt
aaccaggaaacggaagggattcccatcctctgcactaaagaggggttgtggacccaggaa
ttcaagttgtgtgaaaacctgcaaggagaatgcccaccacccacctcagagctgaattct
gtggagtacaagtgtggacagggatatgggatcggtgcagtgtgctccccatcatgtgta
atcccccctagtgaccctgtgatactaccagagaatgtgactactgacactttggagcac
tggatggaacctgtcaaagtccagagtatcgtgtgtaccggcaggcgccagtggcaccca
gatccctctctggtgcactgcatccagtcatgtgagcctttccaagcagatggttggtgt
gacactattaataaccgggcctactgcaactatgacgggggagactgctgctcttccaca
ctctcttccaagaaggtcattccatttgctgctgattgtgacttggatgaatgcacctgt
cgagaccccaaggcagaagaaaaccagtaa

DBGET integrated database retrieval system