KEGG   Mus musculus (mouse): 23854Help
Entry
23854             CDS       T01002                                 

Gene name
Def8, AI449518, D8Ertd713e, DEF-8
Definition
(RefSeq) differentially expressed in FDCP 8
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_9 C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 23854
NCBI-ProteinID: NP_001268732
MGI: 1346331
Ensembl: ENSMUSG00000001482
Vega: OTTMUSG00000022172
UniProt: Q99J78
Position
8 E1; 8 72.1 cM
AA seq 448 aa AA seqDB search
MEYDEKLVRFRQAHLNPFNKQLGPRHHEQEPSEKVTSEDTLPELPAGEPEFHYSERMMDL
GLSEDHFSRPVGLFLASDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQEL
KDPNEEEPNIRVLLEHRFYKEKSKSVKQTCDKCNTIIWGLIQTWYTCTGCCYRCHSKCLN
LISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAECRAPISLRGVPSEARQCDYTGQYY
CSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLLFNYVEEL
VEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRLSC
SLTEIHTLFAKHIKLDCERCQAKGFVCELCKEGDVLFPFDSHTSVCNDCSAVFHRDCYYD
NSTTCPKCARLTLRKQSLFQEPGLDMDA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgatgagaagctggttcggttccggcaggcccacctcaaccccttcaacaag
cagcttggtccgaggcatcatgaacaggaacccagtgagaaggtcacttctgaagacact
ttgcctgagctgcccgctggggagcctgaattccactactcggagcgcatgatggatctc
ggcctgtctgaggaccacttttcccgccctgtgggtctcttcctggcctctgatgtccag
cagctgcggcaggccatcgaagaatgcaaacaggtgatcctggagctgcccgagcagtca
gagaagcagaaggacgctgtggtgcggctgatccacctccggctgaagctccaggagctg
aaggaccccaatgaggaggaacccaacatccgggttctcctggaacatcgcttctacaag
gagaagagcaagagcgttaaacagacctgcgataagtgcaacaccatcatctgggggctc
atccagacctggtacacctgcacagggtgttgttaccgctgtcacagcaagtgcctgaac
ctcatctccaaaccatgtgtcagctccaaggtcagtcaccaggctgagtatgagctgaac
atctgccctgagaccgggctggacagccaggactaccgctgtgcggagtgccgtgctccc
atctctctgagaggtgtgcctagtgaggcccggcagtgtgactacacgggccaatactac
tgcagccactgccactggaacgacctggctgtcatccccgcgagagtggtgcacaactgg
gactttgagccacgcaaggtgtcccgttgcagcatgcgctacctggcactgatggtgtct
cggccagtgctccggctccgggagattaaccctttgctgtttaactacgtggaagagctg
gtggagatccggaaactgcgccaggacatcctgctcatgaagccatacttcatcacctgc
aaggaggccatggaggcgcgactactgctgcagctccaagacagacagcattttgtggag
aacgatgagatgtactctatccaggacctcttggaagtgcacatgggccgcctcagctgc
tcgctcactgagatccacacgctcttcgccaagcacatcaagttggactgtgagcggtgc
caagccaaggggttcgtctgtgaactctgcaaagaaggggacgtgctcttcccgttcgac
agccacacgtctgtgtgcaatgactgttcggctgtcttccacagggactgttactacgac
aactcgaccacgtgccccaagtgtgcccggctcacattgaggaagcagtcactattccag
gaacctggcctagacatggatgcctag

DBGET integrated database retrieval system