KEGG   Mus musculus (mouse): 238564
Entry
238564            CDS       T01002                                 

Gene name
Mylk4, EG238564
Definition
(RefSeq) myosin light chain kinase family, member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    238564 (Mylk4)
   04020 Calcium signaling pathway
    238564 (Mylk4)
   04022 cGMP-PKG signaling pathway
    238564 (Mylk4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    238564 (Mylk4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    238564 (Mylk4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    238564 (Mylk4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    238564 (Mylk4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    238564 (Mylk4)
  09154 Digestive system
   04971 Gastric acid secretion
    238564 (Mylk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    238564 (Mylk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     238564 (Mylk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   238564 (Mylk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like
Other DBs
NCBI-GeneID: 238564
NCBI-ProteinID: NP_001355809
MGI: 3643758
Ensembl: ENSMUSG00000044951
Vega: OTTMUSG00000000690
Position
13; 13 A3.2
AA seq 624 aa
MLKVKRLEEISSCHSSNPLEKVAFFQCMEEVEKVKCFLEENSGDLDLQSGDNEAEENVWS
NRALDERIIVKGGRTSALTEKTDQNDQFSSEKEKITKLNKKNSEKTSALEVQRSCVICHV
ERQDKIEFVQRNSTELRENAGAKDAPCIESLEKQESNNLRDKQDTEDNNGGENGISSKDD
SRGVEAENRASAAASGAVLDKHSTESQHTEDMNGDPSHERCISNIKTTSTPGILGNSASG
STFQNAEQTESTGSSKRRVAEECFLSEDNKKSRIDVVRRGEEPTARTEETRQARSLGDRL
QDGMTTSREQDLEVPLDDIPAPAAPFDHRMVMAKHASVDNLYTVSKSEILGGGRFGQVHK
CEEKATGLKLAAKIIKTRGAKDKEDVKNEISVMNQLDHVNLIQLYDAFESKHDIILVMEY
VEGGELFDRIIDENCNLTELDTILFMKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQ
IKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFSTDMWSVGVITYMLLSGLSP
FLGDNDAETLTNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLS
DHKLHSRLSAQKNCNSGVLNLTTK
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgttgaaggtgaagaggctggaagaaatcagctcgtgccacagcagcaacccgctggag
aaggtggcgtttttccagtgcatggaggaggtggagaaggtgaaatgcttcctggaggag
aattcgggggatctggacctgcagtctggagacaatgaggctgaggaaaatgtatggtcc
aaccgtgcactagatgaaaggataattgtcaaaggaggaaggacatcagccctcacagag
aaaactgaccagaatgaccaattctcttccgagaaagaaaagattaccaaacttaacaag
aaaaattcagagaagaccagtgcattagaagtgcagaggagttgtgtcatatgtcacgtg
gaaagacaagacaagatagaatttgttcagaggaattccacagagctaagagagaatgca
ggtgcaaaagatgctccatgcatagaaagtctggagaaacaagaaagcaacaacctgaga
gataaacaagacactgaagataacaatggaggagaaaatgggatttcttctaaggacgat
tccagaggagtagaagctgagaacagagcttcagcagctgcaagtggagcagtgctagac
aaacactcgactgaaagccagcacactgaggacatgaatggtgacccgtcccatgaaagg
tgcatcagtaatataaagaccacttctacaccaggaatccttggaaattcagcatcagga
tccactttccagaatgctgaacagacagagtctactggcagcagtaagcgcagggtggca
gaggagtgcttcctcagtgaggacaacaaaaagagcagaatagatgtagtgagaagaggg
gaagagcccacagctaggacagaggaaaccaggcaagccagaagcctgggtgatagactc
caggatggaatgaccacctctagagagcaagacctggaggtcccactggatgacatccct
gctcctgccgctccatttgatcatcggatggtaatggccaaacatgcttcagtggacaat
ctgtacaccgtgagcaaatctgagatcctaggaggggggcgttttggtcaggtacataag
tgtgaagagaaagcaacaggcctgaagctggctgctaaaatcattaagactagaggtgca
aaggacaaggaggatgtgaagaacgagatcagcgtcatgaaccagctggaccacgtgaac
ctcattcagctctatgatgcctttgagtccaagcatgacatcatccttgtcatggagtat
gtggagggtggggagctctttgaccgcatcattgatgaaaactgcaacttgacagagctg
gacaccatcctgttcatgaagcagatctgtgaggggatacggtacatgcaccagatgtac
atcctccacttggatctcaagcctgagaacatcctgtgtgtgaatcgggatgctaagcaa
ataaaaattattgattttggattggccagaagatacaagcccagagagaagctgaaggtg
aactttggaaccccagaatttcttgcccctgaagttgtgaactatgatttcgtttccttt
tctacagatatgtggagtgtgggcgtcatcacatacatgctactcagtggcttgtccccc
tttttgggagacaatgatgccgagacactgaccaacatcctggcgtgccggtgggattta
gaagatgaggaatttcaggatatctcggaggaggcaaaggagttcatctccaagctcctg
attaaggagaagagttggagaataagtgccagcgaagctctcaagcacccatggttgtca
gaccacaagctccactccaggctgagtgcacagaagaactgcaactctggtgttctgaac
ctcacgaccaaataa

DBGET integrated database retrieval system