KEGG   Mus musculus (mouse): 23872
Entry
23872             CDS       T01002                                 

Gene name
Ets2, AU022856, Ets-, Ets-2
Definition
(RefSeq) E26 avian leukemia oncogene 2, 3' domain
  KO
K21932  C-ets-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    23872 (Ets2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    23872 (Ets2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    23872 (Ets2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    23872 (Ets2)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 23872
NCBI-ProteinID: NP_035939
MGI: 95456
Ensembl: ENSMUSG00000022895
Vega: OTTMUSG00000027024
UniProt: P15037 Q3UP99
Position
16 C4; 16 56.64 cM
AA seq 468 aa
MNDFGIKNMDQVAPVANSFRGTLKRQPAFDTFDGSLFAVLPSLSEDQTLQEVPTGLDSVS
HDSASCELPLLTPCSKAVMSQALKATFSGFQKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLHQFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLNAVPHWINSNTLGFSMEQAPYGMQAPNYPKDNLLDSMCPPSATPAALGSELQMLPK
SRLNTVNVNYCSISQDFPSSNVNLLNNNSGKPKDHDSPENGGDSFESSDSLLRSWNSQSS
LLDVQRVPSFESFEEDCSQSLCLSKLTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSG
PIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGL
RYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaatgactttggaatcaagaacatggaccaagtggcccctgtcgccaacagttttcgt
gggacactcaagcgccagccagcctttgacaccttcgatggctctctgtttgctgtgctc
ccttctctcagtgaagatcagacactccaagaagtgcccacgggcctggattctgtctcc
catgactcggccagctgcgagctgcctttgctcactccctgcagcaaggcagtgatgagc
caagccttaaaagccaccttcagtggcttccaaaaggagcaacgacgtcttggcatcccc
aaaaacccctggctgtggagcgagcagcaggtgtgccagtggcttctctgggccaccaac
gagttcagcctggtgaatgtgaacctgcaccagtttggcatgaacggccagatgctgtgt
aacctcggcaaggagcgcttcctggagctggcgcctgactttgtgggtgacatcctctgg
gaacatctagagcagatgatcaaagagaaccaagaaaagacagaagaccaatatgaggaa
aactctcacctcaacgcggttcctcattggatcaacagcaatacattaggcttcagcatg
gaacaggctccatatggaatgcaggcaccaaactaccccaaagacaatctcctggacagc
atgtgcccgccatcggccacgcctgcagctctgggctctgagctccagatgttgcccaag
tctcggctcaacaccgtcaatgtcaattactgttccatcagccaggacttccccagcagc
aacgtgaatttgctcaacaacaattctggaaaacccaaggaccacgactctccagagaac
ggtggggacagcttcgagagctccgactcgctgctgaggtcctggaacagccagtcgtcc
ctactggatgtacagcgggtaccttccttcgagagctttgaggaggactgtagccagtct
ctgtgcctcagtaagctgaccatgtccttcaaggactacatccaagagaggagcgaccca
gtcgagcaaggcaaaccagttattcctgcagcagtactggctggcttcactggaagcgga
ccaatccagttgtggcagtttcttctggagctactctctgacaagtcctgtcaatctttc
atcagctggacgggggatggatgggagttcaagcttgctgaccccgatgaggttgcccgc
cggtgggggaagaggaaaaataaaccaaagatgaactacgagaagctgagccggggctta
cgttactactacgacaagaacatcatccacaagacttcgggcaagcgctacgtgtaccgt
ttcgtatgtgacctgcagaacttgctgggcttcactccggaggaactgcatgccatcctg
ggcgtccagcctgatacagaagactga

DBGET integrated database retrieval system