KEGG   Mus musculus (mouse): 238725
Entry
238725            CDS       T01002                                 

Gene name
Gpr150, C030001A19Rik, PGR11
Definition
(RefSeq) G protein-coupled receptor 150
  KO
K08434  G protein-coupled receptor 150
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    238725 (Gpr150)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    238725 (Gpr150)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 238725
NCBI-ProteinID: NP_780704
MGI: 2441872
Ensembl: ENSMUSG00000045509
Vega: OTTMUSG00000017555
UniProt: Q8BL07
Position
13; 13 C1
AA seq 427 aa
MEDPFSLAILNPASNLSVPTQPSWSLNLTSEQGASVPGPHSPPRGPPSHRIHLVFLGIIL
VAAVAGNTTVLCRLCGGSSGPWPGPKRRKMDFLLVQLAAADLYASGGTALSQLAWELLGD
PRPALGDLACRLSHLLQASGRGASAHLVALIALERQLAVRIPQGPQLPARALAALSWLLA
LLLALPPTFVVRWDAPPSSTANAWPGKHCCRGIFAPLPRWHLQVYALYEAIVGFAAPVAL
LGFSCGHLLCVWWQRGSQAPVARMPWSPSMARASLPSALPQAKVQSLKMSLALALLFVGC
DLPYFAARLAAAWSSKPAGDWERESLVAAMRVLEVANSAINPLIYLFFQAGDCRLWRRLR
RRLGVLCCVREEEADISEWAGDHQALHRHRWPHPHYHHARREERNQGCLRPPPPRPRPPP
CSCESAF
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaagatcctttcagcctcgcaattctgaatcccgcatccaacctttctgtacccact
cagccaagctggagtctcaacctgacttctgagcaaggagcctctgtcccaggaccgcat
tcgcctccacgcgggccacccagccaccggatccatctggtcttcttggggatcatcctg
gtggccgcggtagctggcaacaccactgtgctctgccgcctgtgcggcggtagcagcgga
ccctggccgggtcccaagcgtcgcaagatggacttcctgcttgtgcagctagcagcggct
gacctgtacgcaagtggaggaacagcattgtcgcagctggcttgggagctgctgggcgac
ccgagaccggctctgggcgacttggcttgtcgcctttcccatctgctgcaggcatcgggg
cggggcgcctccgcccacctggtggcgctcattgccttggagcgccagctcgcggtgcgc
attcctcagggccctcagttgccagcacgtgccctggctgccctgagctggctgctggct
ctgctactggcgctgcctccgaccttcgtggtgcgctgggatgctcctccatcttcaacc
gccaatgcctggccagggaagcattgctgcaggggcatcttcgcgcccctgccgcgctgg
cacctgcaggtctacgcgctctatgaagctatcgtgggcttcgcggcgccggtcgctctc
ttaggcttctcttgcggccacctgctgtgtgtctggtggcagcgtgggtctcaggctccg
gtggctaggatgccctggtcgcccagtatggccagagcctccttgcccagcgcgttgccc
caagccaaggtgcaaagcttgaaaatgagcctggcgctggcactgctcttcgtgggctgc
gacctgccctacttcgccgctcgcttggcagccgcctggtcatcgaagcccgcgggtgac
tgggagagagagagcctggtggcggcgatgcgcgtcctagaggtggccaacagcgccatc
aaccctttgatctaccttttcttccaggcgggcgactgccgtctctggcggaggctgcgg
aggcgcctaggagttctgtgctgcgtgcgggaggaagaagccgatatcagcgaatgggct
ggggaccaccaggcactccaccgccatcgctggccccaccctcattatcaccatgcccgg
cgggaggagcggaaccagggctgcctgcgcccacccccgccacgccccagaccgccgccc
tgctcctgtgaaagtgccttctag

DBGET integrated database retrieval system