KEGG   Mus musculus (mouse): 23873Help
Entry
23873             CDS       T01002                                 

Gene name
Faim
Definition
(RefSeq) Fas apoptotic inhibitory molecule
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FAIM1 DUF5640 DUF3748
Motif
Other DBs
NCBI-GeneID: 23873
NCBI-ProteinID: NP_035940
MGI: 1344387
Ensembl: ENSMUSG00000032463
Vega: OTTMUSG00000048179
UniProt: Q9WUD8
Structure
PDB: 

Position
9; 9 E3.3
AA seq 179 aa AA seqDB search
MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVGKETFFVGAAK
TKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDGEDLRVVLEKDTMDV
WCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctcgtagctgtttgggacgtagcattaagtgacggagtccacaagattgaa
tttgaacatgggaccacatcaggcaagcgggttgtgtacgtggatgggaaggaagagata
agaagagagtggatgttcaagttggtgggcaaagaaacgttctttgtcggagctgcaaaa
accaaagccaccatcaatatagatgccataagtggcttcgcatacgagtacacgctggaa
attgatgggaagagcctcaagaagtacatggagaacaggtcaaagaccaccagcacctgg
gtgctgcgcctggatggcgaggacctgagagttgttttggaaaaagacactatggacgta
tggtgcaatggtcagaaaatggagacagcgggcgagtttgtagatgatgggactgagacg
cacttcagcgttgggaaccacggctgttacataaaagctgtgagcagcggaaagaggaaa
gaagggattatccataccctcattgtggataacagggaaatcccagagctcactcagtga

DBGET integrated database retrieval system