KEGG   Mus musculus (house mouse): 23876
Entry
23876             CDS       T01002                                 
Symbol
Fbln5, A55, DANCE, EVEC
Name
(RefSeq) fibulin 5
  KO
K17340  fibulin 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    23876 (Fbln5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   23876 (Fbln5)
SSDB
Motif
Pfam: EGF_CA cEGF FXa_inhibition EGF_3 hEGF EGF Plasmod_Pvs28
Other DBs
NCBI-GeneID: 23876
NCBI-ProteinID: NP_035942
MGI: 1346091
Ensembl: ENSMUSG00000021186
UniProt: Q9WVH9
Position
12:complement(101712824..101785541)
AA seq 448 aa
MPGLKRILTVTILALWLPHPGNAQQQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSTSYSGPYPAAAPPVPASNYPTISRPLVCRFGYQMD
EGNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNDDGRSCQDVNECETENPCVQTCVNTYGSFICRCDPGYELEE
DGIHCSDMDECSFSEFLCQHECVNQPGSYFCSCPPGYVLLDDNRSCQDINECEHRNHTCT
SLQTCYNLQGGFKCIDPISCEEPYLLIGENRCMCPAEHTSCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccaggattaaaaaggatactcactgttaccatcttggcactctggcttccacatcct
gggaatgcacagcagcagtgcacaaacggctttgacctggaccgccagtcaggacagtgt
ctagatattgatgaatgccggaccatccctgaggcttgtcgtggggacatgatgtgtgtc
aaccagaatggcgggtatttgtgcatccctcgaaccaacccagtgtatcgagggccttac
tcaaatccctactctacatcctactcaggcccatacccagcagcggccccaccagtacca
gcttccaactaccccacgatttcaaggcctcttgtctgccgctttgggtatcagatggat
gaaggcaaccagtgtgtggatgtggacgagtgtgcaacagactcacaccagtgcaaccct
acccagatctgtatcaacactgaaggaggttacacctgctcctgcaccgatgggtactgg
cttctggaagggcagtgcctagatattgatgaatgtcgctatggttactgccagcagctc
tgtgcaaatgttccaggatcctattcctgtacatgcaaccctggtttcaccctcaacgac
gatggaaggtcttgccaagatgtgaacgagtgcgaaactgagaatccctgtgttcagacc
tgtgtcaacacctatggctctttcatctgccgctgtgacccaggatatgaacttgaggaa
gatggcattcactgcagtgatatggacgagtgcagcttctccgagttcctctgtcaacac
gagtgtgtgaaccagccgggctcatacttctgctcgtgccctccaggctacgtcctgttg
gatgataaccgaagctgccaggatatcaatgaatgtgagcaccgaaaccacacgtgtacc
tcactgcagacttgctacaatctacaagggggcttcaaatgtattgatcccatcagctgt
gaggagccttatctgctgattggtgaaaaccgctgtatgtgtcctgctgagcacaccagc
tgcagagaccagccattcaccatcctgtatcgggacatggatgtggtgtcaggacgctcc
gttcctgctgacatcttccagatgcaagcaacaacccgataccctggtgcctattacatt
ttccagatcaaatctggcaacgagggtcgagagttctatatgcggcaaacagggcctatc
agtgccaccctggtgatgacacgccccatcaaagggcctcgggacatccagctggacttg
gagatgatcactgtcaacactgtcatcaacttcagaggcagctccgtgatccgactgcgg
atatatgtgtcgcagtatccgttctga

DBGET integrated database retrieval system