KEGG   Mus musculus (mouse): 238799Help
Entry
238799            CDS       T01002                                 

Gene name
Tnpo1, AU021749, D13Ertd688e, IPO2, Kpnb2, MIP, MIP1, TRN
Definition
(RefSeq) transportin 1
  KO
K18752  transportin-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    238799 (Tnpo1)
   03009 Ribosome biogenesis [BR:mmu03009]
    238799 (Tnpo1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     238799 (Tnpo1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    238799 (Tnpo1)
  Pre-60S particles
    238799 (Tnpo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_EZ HEAT HEAT_2 Arm IBN_N Cnd1 Vac14_Fab1_bd Adaptin_N UNC45-central CLASP_N Dopey_N MMS19_C RTP1_C1 DUF3689 Urb2
Motif
Other DBs
NCBI-GeneID: 238799
NCBI-ProteinID: NP_848831
MGI: 2681523
Ensembl: ENSMUSG00000009470
Vega: OTTMUSG00000024774
UniProt: Q8BFY9
Position
13 D1; 13 52.24 cM
AA seq 898 aa AA seqDB search
MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIF
VLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGI
LITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPL
NIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEAEVR
KNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDV
LVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHEED
GIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWV
VKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQ
PPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSK
YQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSS
VATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPEQYEAPDKDFMIVALDLLSGLA
EGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPI
LGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTA
ITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDF
IFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggaccggcaaaccaagatggagtatgagtggaaacctgacgagcaagggctt
cagcagatcctgcagctgctcaaggagtcccagtccccagacaccaccatccagaggacc
gtgcaacaaaaactggaacaactcaatcaatatccagattttaacaactacttgattttt
gttcttacaaaattaaaatctgaagatgagcccacacggtcattgagcggtctgatcttg
aagaacaatgtgaaagctcattttcagaacttcccaaatggtgtgacagacttcatcaag
agtgaatgtctaaataacattggggactcctctccgttgatcagagccactgtcggtatt
ttaattacaaccatagcctccaagggagagctgcagaattggcctgatctcttaccaaaa
ctctgtagcctgctggattccgaagactacaacacttgtgagggagccttcggtgccctt
cagaagatatgtgaggactctgcagagattttagacagtgatgtcttagatcgccctctc
aacatcatgatccccaagtttttacagtttttcaagcacagcagtcccaaaataaggtct
catgctgttgcatgtgtcaatcagttcatcatcagtcggacccaggcgctcatgctgcac
atcgattccttcattgagaacctctttgcactggctggcgacgaggaagcagaggtgcgg
aagaacgtgtgccgggcgcttgtgatgttgcttgaagtccggatggatcgcctgcttcct
catatgcacaacatagtcgagtacatgctgcagagaacccaagaccaagatgagaatgta
gctctggaggcctgtgaattctggctgactttggctgaacagccaatatgcaaagatgta
cttgtaaggcatctaccaaagttgattcctgtgttagtgaatggcatgaagtactcagat
atagatattatcctgcttaagggtgatgttgaggaagatgagaccatcccggatagtgag
caggatatacggccgcggtttcatcgctcgaggacagtggctcagcagcatgaggaggat
gggattgaggaggaagacgatgatgatgacgaaattgatgatgatgacacgatttctgac
tggaacctgagaaagtgttctgctgctgctctcgatgttctcgcaaatgtttatcgtgat
gagcttttgccgcacattctgccacttttgaaagaattgcttttccatcatgaatgggtt
gtgaaagaatctggcatcttggttttaggagcaattgctgaaggttgtatgcaaggcatg
attccgtacctgcccgagctcattcctcaccttattcagtgcctttctgataaaaaggct
cttgtgcgttccatcacctgctggactcttagccgctatgcacactgggtagtcagccag
ccaccagatacgtacctgaagccattaatgacagaactgctgaagcgtatcctcgatagc
aacaagagagtacaggaagcagcttgcagtgccttcgctacattagaagaggaggcttgt
acagagctcgtcccttaccttgcttatatactcgataccctcgtcttcgccttcagtaaa
taccagcataagaacctgctcattctgtacgacgccatagggacactggcagattcagtg
ggacatcatttaaacaagccagaatatattcagatgctaatgcctcctttgatccagaaa
tggaacatgctgaaggatgaagacaaggatcttttccctttgcttgagtgtctctcgtct
gttgccacagccttgcagtctggcttccttccatattgtgaacctgtatatcagcgttgc
gtaaacctagttcagaagactctggcacaagccatgctaaacaatgctcaaccagaacag
tatgaagctccagataaagattttatgattgtggctcttgacttactcagcggcctggct
gagggcctgggaggcaacattgagcagctggtggcccgcagtaacatcctgacgctgatg
taccagtgcatgcaggataaaatgcccgaggttcggcagagttcttttgcattgctaggt
gacctgactaaagcgtgcttccagcatgttaagccttgtatagctgatttcatgccaata
ttgggaaccaatctaaatccagagtttatttcagtctgcaacaatgccacctgggcgatt
ggggaaatatcaatccaaatgggtatagagatgcagccctacatccctatggtgttgcac
cagcttgtggagatcattaacagacccaacaccccaaagacgctgttggagaacacagca
ataacaattggtcgtcttggttacgtttgtcctcaagaggtggcccccatgctacagcag
tttataagaccctggtgtacctctctgagaaacataagagacaatgaagaaaaagattca
gcattccgtgggatttgtaccatgatcagtgtgaatcccagtggcgtaatccaagatttt
atatttttttgtgatgctgttgcatcatggattaacccaaaagatgatctcagagacatg
ttctgtaagatccttcatggatttaaaaaccaagttggggatgaaaattggaggcgattc
tctgaccagtttcctcttcccttaaaagagcgtcttgcagctttttatggtgtttaa

DBGET integrated database retrieval system