KEGG   Mus musculus (mouse): 23886
Entry
23886             CDS       T01002                                 

Gene name
Gdf15, MIC-1, NAG-1, SBF
Definition
(RefSeq) growth differentiation factor 15
  KO
K05504  growth differentiation factor 15
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23886 (Gdf15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    23886 (Gdf15)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   23886 (Gdf15)
SSDB
Motif
Pfam: TGF_beta BcsB
Other DBs
NCBI-GeneID: 23886
NCBI-ProteinID: NP_001317616
MGI: 1346047
Ensembl: ENSMUSG00000038508
Vega: OTTMUSG00000023705
UniProt: Q9Z0J7
Position
8; 8 B3.3
AA seq 303 aa
MAPPALQAQPPGGSQLRFLLFLLLLLLLLSWPSQGDALAMPEQRPSGPESQLNADELRGR
FQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVRLGSHGQLLLRVNRASLSQGLPEAYR
VHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLTPPPDLAMLPSGGTQLELRLR
VAAGRGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECP
HLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGC
HCA
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccccgcccgcgctccaggcccagcctccaggcggctctcaactgaggttcctgctg
ttcctgctgctgttgctgctgctgctgtcatggccatcgcagggggacgccctggcaatg
cctgaacagcgaccctccggccctgagtcccaactcaacgccgacgagctacggggtcgc
ttccaggacctgctgagccggctgcatgccaaccagagccgagaggactcgaactcagaa
ccaagtcctgacccagctgtccggatactcagtccagaggtgagattggggtcccacggc
cagctgctactccgcgtcaaccgggcgtcgctgagtcagggtctccccgaagcctaccgc
gtgcaccgagcgctgctcctgctgacgccgacggcccgcccctgggacatcactaggccc
ctgaagcgtgcgctcagcctccggggaccccgtgctcccgcattacgcctgcgcctgacg
ccgcctccggacctggctatgctgccctctggcggcacgcagctggaactgcgcttacgg
gtagccgccggcagggggcgccgaagcgcgcatgcgcacccaagagactcgtgcccactg
ggtccggggcgctgctgtcacttggagactgtgcaggcaactcttgaagacttgggctgg
agcgactgggtgctgtccccgcgccagctgcagctgagcatgtgcgtgggcgagtgtccc
cacctgtatcgctccgcgaacacgcatgcgcagatcaaagcacgcctgcatggcctgcag
cctgacaaggtgcctgccccgtgctgtgtcccctccagctacaccccggtggttcttatg
cacaggacagacagtggtgtgtcactgcagacttatgatgacctggtggcccggggctgc
cactgcgcttga

DBGET integrated database retrieval system