KEGG   Mus musculus (mouse): 238871
Entry
238871            CDS       T01002                                 

Gene name
Pde4d, 9630011N22Rik, Dpde3
Definition
(RefSeq) phosphodiesterase 4D, cAMP specific
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04024  cAMP signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    238871 (Pde4d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    238871 (Pde4d)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    238871 (Pde4d)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    238871 (Pde4d)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     238871 (Pde4d)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 238871
NCBI-ProteinID: NP_035186
MGI: 99555
Ensembl: ENSMUSG00000021699
Vega: OTTMUSG00000031955
UniProt: Q01063 A2RSH1
Position
13 D2.1; 13 59.69 cM
AA seq 747 aa
MERDTCDVLSRSKSASEETLHSCNEEEDPFRGMEPYLVRRLSSRSIQLPPLAFRQLEQAD
LRSESENIPRPTSLPLKILPLIAVTSADSSGFDVDNGTSAGRSPLDPMTSPGSGLILQAN
FVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFA
ALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVS
EMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKRPM
SQISGVKKLMHSSSLTNSCIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLT
VIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTP
ALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFK
LLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLL
LDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCD
KHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPD
DQEEGRQGQTEKFQFELTLEEDCESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLD
EQVEEEAVAEEESQPETCVPDDCCPDT
NT seq 2244 nt   +upstreamnt  +downstreamnt
atggagagggacacttgtgatgtactctctcggagcaaaagtgcctctgaggaaacactg
cactcctgtaatgaagaagaggacccttttcgtggaatggagccctatctcgtacggcga
ctttcttcccgcagcattcagcttccacctctggccttcagacagttggaacaagcagac
ttgcgaagcgaatcagagaacatccctcggccaactagcctccccttgaaaatcctgcct
ctgatcgccgtcacatctgcagactcaagtggtttcgatgtggacaatggcacatcagcg
ggacggagtcccttggatcccatgaccagcccagggtctgggctgattctccaagcaaac
tttgtccacagtcaacgccgggagtccttcctgtaccgatctgacagcgactatgacctc
tctccaaagtctatgtccaggaactcctcgattgccagtgatatacatggagatgacttg
attgtgaccccgtttgctcaggtcttggctagcctgcgaaccgtacggaacaactttgct
gcgttaacgaatttgcaagaccgagcacccagcaaaagatcacccatgtgcaaccaacca
tccatcaacaaagccaccatcacagaggaggcctaccagaaactggccagcgagaccctg
gaggagctggactggtgtctggaccagctagagaccctgcagaccaggcactccgtcagt
gagatggcctccaacaagttcaaaaggatgctgaaccgggagctcacgcatctctctgag
atgagtcggtctggcaaccaggtgtcggagtacatctcaaacacatttctcgataagcaa
catgaagtggaaatcccctctccaactcagaaggaaaaggagaagaagaaaaggccgatg
tcgcagatcagtggggtcaagaagttgatgcacagctccagcctaactaattcatgtatc
cccaggtttggggttaaaacggagcaggaagatgtcctggccaaggaactagaagatgtg
aacaagtggggcctccacgttttccgaatagcagagctgtctggtaaccggcctctgact
gttatcatgcacaccatttttcaggaacgagatttgttaaaaacgtttaaaatcccagta
gacactttgattacgtatcttatgactctggaagaccattaccatgctgacgtggcctat
cacaacaacatccatgctgcagacgtcgtccagtccactcacgtgctgctctctacaccc
gctttggaggctgtgttcacagacttggagattctcgcggccatttttgccagtgcaata
catgatgtggaccatcctggggtgtcaaatcaatttctgatcaatacaaactcggaactc
gctctgatgtacaacgactcctcggtcctagagaaccatcacttggcggtgggctttaag
ttgctccaggaagaaaactgtgacattttccagaatctgaccaaaaagcaaagacaatct
ttaaggaaaatggtcattgacattgtcctggcgacagacatgtcgaagcacatgaacctg
ctggctgatctgaaaaccatggttgaaaccaagaaggtgacaagctccggcgtcctcctc
ctggataactactccgacaggatccaggtccttcagaatatggtgcactgtgcagacctg
agcaaccccacaaagccactccagctgtaccgccagtggacggaccggataatggaggag
ttcttccgccagggggaccgagagcgggagcgtggcatggagataagtcccatgtgtgac
aagcacaacgcctctgtggaaaaatcacaggtgggcttcatagactatatcgttcatcca
ctctgggagacgtgggcagacctcgtacatcccgatgcccaggacatcttggacactttg
gaggacaatcgtgagtggtaccagagcacaatcccccagagcccctcccctgcacctgat
gaccaagaggagggccggcagggacagactgaaaaattccagtttgaactaaccttggag
gaagactgcgagtcagacactgaaaaggacagtggaagtcaggtggaggaagacactagc
tgcagtgactctaagactctgtgcacccaagactcagagtccactgaaattccccttgac
gagcaggttgaggaggaagctgtagcggaagaggaaagccagcctgaaacttgcgtccca
gatgactgctgtcctgatacgtaa

DBGET integrated database retrieval system