KEGG   Mus musculus (mouse): 23888
Entry
23888             CDS       T01002                                 

Gene name
Gpc6
Definition
(RefSeq) glypican 6
  KO
K08112  glypican 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    23888 (Gpc6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    23888 (Gpc6)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   23888 (Gpc6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  23888 (Gpc6)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 23888
NCBI-ProteinID: NP_035951
MGI: 1346322
Ensembl: ENSMUSG00000058571
Vega: OTTMUSG00000018004
UniProt: Q9R087 Q3V1C9 Q3TP69
Position
14; 14 E4
AA seq 555 aa
MPSWIRAVILPLSGLLLTLPAAADVKARSCSEVRQAYGAKGFSLADIPYQEIAGEHLRIC
PQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSL
NDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQY
HFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSP
TPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAE
RLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENF
NTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDERVTAGTSNEE
ECWNGHSKARYLPEIMNDGLTNQINNPEVEVDITRPDTFIRQQIMALRVMTNKLKNAYNG
NDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREEESSASKFSSSLIS
WSLVCMVLALQRLYR
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgccttcttggatccgggctgtgattcttcctctctccgggctgctgctgaccctcccg
gccgcggcggacgtgaaggctcggagctgcagcgaggtccgtcaggcttacggtgccaag
ggattcagcctggcggacatcccctaccaggagatcgcaggggagcacttacgcatctgc
cctcaggaatatacctgctgcaccacagaaatggaagacaagctgagtcaacagagtaaa
ctggagtttgaaaaccttgtagaagagacaagccactttgtgaggaccacgtttgtgtcg
aggcacaagaaatttgatgagtttttccgagagctgctggaaaacgcagaaaagtcccta
aatgacatgtttgtccggacctacgggatgctgtacatgcagaattcagaggtattccag
gacctcttcactgagctaaagcggtactacacagggggtaacgtcaacctggaagagatg
ctcaatgacttctgggctcggctcctggagaggatgttccagctgattaaccctcagtat
cacttcagcgaggactacctggagtgtgtaagcaagtacacagaccagctgaagccattt
ggagacgtgccacggaaactgaagattcaggtcacccgcgccttcatcgcggctcgcacc
tttgtccagggcctgacagtgggcagagaggttgccaaccgagtttccaaggtgagcccc
acccctggctgcatccgggctctcatgaagatgctgtactgcccatactgccgaggcttg
cccactgtgagaccttgcaacaactactgcctcaacgtcatgaagggctgcctggccaat
caggcagatttggacactgagtggaatctcttcatagatgcaatgctcttggtggctgag
cgactggaagggccattcaacattgagtcagtcatggacccaatagacgtcaagatctct
gaagccattatgaacatgcaggaaaacagcatgcaggtgtcagcaaaggtctttcagggc
tgtggccagcccaaacctgctcccgctctcagatctgctcgctcagctccagaaaatttt
aacacccgttttcggccctacaaccctgaggaaagacccacaactgcagcgggcacgagc
ttggaccggctggtcacagacataaaagagaagctgaagctctctaaaaaggtctggtca
gcattgccctacaccatctgcaaggacgaacgtgtgacagcaggaacctccaacgaggag
gagtgctggaacggacacagcaaagccagatacctgcctgagatcatgaacgatgggctg
accaaccaaatcaacaatcctgaggtggaggtggacatcacgcggccagacactttcatc
agacagcagatcatggctctccgtgtgatgaccaacaaactgaagaatgcgtacaatggc
aatgacgtcaacttccaagacacaagcgatgaatccagtggctcaggcagcggcagtggt
tgcatggatgatgtgtgtcccacggagttcgagtttgtcaccaccgaggccccggcggtg
gacccggaccgcagagaagaggaatcttcggcctcgaagttcagctcctccttgatttcc
tggtctctggtctgcatggtcttggccctgcagagactctacagataa

DBGET integrated database retrieval system