KEGG   Mus musculus (mouse): 23890
Entry
23890             CDS       T01002                                 

Symbol
Gpr34, Lypsr1
Name
(RefSeq) G protein-coupled receptor 34
  KO
K08383  G protein-coupled receptor 34
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    23890 (Gpr34)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidylserine
    23890 (Gpr34)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 23890
NCBI-ProteinID: NP_035953
MGI: 1346334
Ensembl: ENSMUSG00000040229
Vega: OTTMUSG00000016906
UniProt: Q9R1K6 Q3YL73
Position
X; X A1.1
AA seq 375 aa
MTTTSVDSWLCSSHGMHFITNYSDQASQNFSGVPNVTSCPMDEKLLSTVLTTFYSVIFLV
GLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQNKWTLGVILC
KVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSIYVCCIVWTVALAGFL
TMIILTLKKGGHNSTMCFHYRDRHNAKGEAIFNFVLVVMFWLIFLLIILSYIKIGKNLLR
ISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIIHK
TNEIMLVFSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQSEASRSESTSEFKPGHSLHD
LSVTVKMPQYSTKGN
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgactactacttcagttgacagctggctttgctcctctcatggaatgcactttataact
aattatagtgaccaagcctcacaaaatttctcaggagtgccaaatgtcactagctgtcca
atggatgaaaaattactatctactgtgttaacaaccttctactctgttatattcctcgtg
ggactggttggaaacatcattgccctctatgtatttctgggcattcaccgtaaaagaaat
tccattcaaatttatctacttaatgtggctgttgcagaccttctactcatcttctgcctc
cctttccgcataatgtatcacatcaaccaaaacaagtggacactaggtgtgattctttgt
aaagttgtggggacactattttacatgaacatgtacattagcattattttgcttgggttt
atcagtttggatcgctatataaaaatcaatcggtctatacaacaaagaagggcaataacc
accaagcaaagtatttatgtttgctgtatagtatggacggttgctcttgctggatttcta
actatgatcattttgacactgaagaagggaggtcataattccacaatgtgtttccattac
agagacagacataatgcaaagggagaagcaatttttaactttgttcttgtagtaatgttc
tggcttattttcctactgataatcctctcatatattaagattggcaagaatctactgagg
atttctaaacggaggtcaaaatttccaaactctggcaaatatgctacaacagcccggaac
tcctttattgtactgatcatttttactatatgctttgtgccttaccatgcctttcggttc
atttacatttcttcacagctaaatgtgtcctcttgttattggaaggaaatcattcacaaa
actaacgagatcatgctggttttctcctctttcaacagttgcctggatcctgtcatgtat
ttcctgatgtccagtaatattcgcaaaatcatgtgtcaacttctttttagaaggtttcaa
agtgaagcaagcagaagtgaaagcacttcagaatttaagccaggacattccttgcatgat
ctgtccgtgacagtcaaaatgccccagtacagcactaagggtaattga

DBGET integrated database retrieval system