KEGG   Mus musculus (mouse): 23900
Entry
23900             CDS       T01002                                 

Gene name
Hcst, DAP, DAP10, KAP, KAP10
Definition
(RefSeq) hematopoietic cell signal transducer
  KO
K07988  hematopoietic cell signal transducer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    23900 (Hcst)
SSDB
Motif
Pfam: DAP10
Other DBs
NCBI-GeneID: 23900
NCBI-ProteinID: NP_035957
MGI: 1344360
Ensembl: ENSMUSG00000064109
Vega: OTTMUSG00000059358
UniProt: Q9QUJ0
Position
7 B1; 7 17.45 cM
AA seq 79 aa
MDPPGYLLFLLLLPVAASQTSAGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRP
HGRPAQEDGRVYINMPGRG
NT seq 240 nt   +upstreamnt  +downstreamnt
atggaccccccaggctacctcctgttcctgcttctgctcccagtggctgcaagtcagaca
tcggcaggttcctgctccggatgtgggactctgtctctgccactcctggcaggcctagtg
gctgcagatgcggtcatgtcactcctaattgtaggggtggtgtttgtatgtatgcgccca
cacggcaggcctgcccaagaagatggtagagtctacatcaacatgcctggcagaggctga

DBGET integrated database retrieval system