KEGG   Mus musculus (house mouse): 239083
Entry
239083            CDS       T01002                                 
Symbol
Ccnb1ip1, Gm288, Hei10, mei4
Name
(RefSeq) cyclin B1 interacting protein 1
  KO
K10639  E3 ubiquitin-protein ligase CCNP1IP1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    239083 (Ccnb1ip1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     239083 (Ccnb1ip1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    239083 (Ccnb1ip1)
SSDB
Motif
Pfam: zf-RING_5 MAD CEP209_CC5
Other DBs
NCBI-GeneID: 239083
NCBI-ProteinID: NP_001104589
MGI: 2685134
Ensembl: ENSMUSG00000071470
UniProt: D3Z3K2
Position
14:complement(51026706..51033185)
AA seq 276 aa
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLD
IVRTELSPSEEYKAMVLAGLRPEVVLDISSRALAFWTYQVHQERLYQEYNFSKAENHLKQ
MEKMYMQQIQSKNIELTSMKGEVISMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDS
LRLRNITIASQEGSLEPGMIPQSGVFGFPPGNNSKFSLDHIPVGNQGGGDEDVQFRPFFV
CSPTAPEPINNFFSFASPSHEAEQQVCSRAFKAKRI
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtctttgtgtgaagacatgctgctttgcaattatcggaagtgtcggatcaagctctct
ggttatgcttgggtcactgcctgttctcacatcttctgcgatcagcacggcagcggggag
ttcagtcgttcaccagcgatctgtcctgcttgcaacagtaccctttctggaaagctagat
attgttcgaacagaactcagtccatcagaggagtacaaagctatggtattggcagggctt
cgcccagaggttgttttggacattagctcccgggcattggccttctggacataccaggta
caccaggagcgtctctatcaagagtataatttcagcaaggccgagaaccacttaaaacag
atggagaagatgtatatgcagcaaatacagagcaagaatatagaattgacctctatgaaa
ggggaggttatttccatgaagaaagttctagaagaatacaagaaaaagtttagtgacatc
tctgaaaaacttatggagcgtaatcgccagtaccaaaagctccaaggcctttatgatagc
cttaggctaagaaatatcactatcgccagccaagaaggctccctggaaccaggtatgatc
ccgcagtctggagtctttggcttcccaccagggaataactcaaagttttctttggaccat
ataccagttggaaatcaaggtggtggagatgaagatgttcagttcagaccattttttgtg
tgttctcccacagcgcctgaacccattaacaacttctttagttttgcatctccaagccat
gaagcagagcagcaagtctgcagcagggcctttaaagcaaaaagaatttag

DBGET integrated database retrieval system