KEGG   Mus musculus (mouse): 239099
Entry
239099            CDS       T01002                                 

Gene name
Homez, mKIAA1443
Definition
(RefSeq) homeodomain leucine zipper-encoding gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Homez Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 239099
NCBI-ProteinID: NP_001171176
MGI: 2678023
Ensembl: ENSMUSG00000057156
Vega: OTTMUSG00000032805
UniProt: Q80W88 A0A0R4J108
Position
14; 14 C2
AA seq 518 aa
MSPNKDASSLNSSAAGLVCLPPVSEELQLVWTQAIQTSELDGNEHLLQAFSYFPYPSLAD
IALLCLRHGLQMEKVKTWFMAQRLRCGISWSSEEIEETRARVVYHRDQLLFKSLLSFTQQ
SVRPPQERPPVLRPEQVALGLSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPL
MMGSRTFSHQSDCQDLQISGLSKEQAGRGPDQSCGKTASWNHFTAVHQPDKPASVSLLDN
SCKEESEPSGIPPSSSTSSPSFQALANGTTATPKPLQPLGCISQSLSPSKKALSPQVEPL
WPQRLWNNSEPNSAGPTEYLSPDMQHQRKTKRKTKEQLAILKSFFLQCQWARREDYHKLE
QITGLPRPEIIQWFGDTRYALKHGQLKWFRDNAVLGTPSFQDPAIPTPSTRSLKEWAKTP
PLPAPPPPPDIRPLEKYWAAHQQLQEADILKLSQASRLSTQQVLDWFDSRLPKPAEVVVC
LDEEDEEDEEDELPEDGEEEEEEEEDDDDGDDDVIIWD
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgagtcctaataaagatgccagcagtctcaacagctctgcagcagggcttgtctgtctc
ccgccagtctcagaggagctacagcttgtgtggactcaagccatccaaaccagtgagctg
gatggaaatgagcacctgctacaagccttcagctacttcccctatccaagcctggcagat
atcgctctcctctgcctgcggcatgggctgcagatggagaaggtaaagacctggttcatg
gcccaacgtctccgctgcggcattagctggtcatctgaagagatagaggagactcgtgcc
agagtggtgtaccaccgagatcagctccttttcaagtctcttctctctttcacacagcag
tcagtgaggcccccacaggagaggcctccagtgctccgtccggagcaggttgctcttgga
ctgagtcctctggcgcctagtgagcagcccactcatatgaaaggattgaaggttgagcct
gaggagccctctcaggtatcacagctgccactgaatcatcagaacgctaaggagcctctg
atgatgggcagcagaacattctcccaccaatcagactgtcaggatcttcagatcagtggc
ctctctaaggagcaggcaggcagaggtcctgaccagtcatgtggaaagactgcttcctgg
aatcacttcacagctgtccatcagccagataagcccgcatcggtctcattacttgataat
agttgtaaggaggaatccgaacctagtggaatacctccatcttcctctacctcttctccc
tctttccaggcattggctaatggaaccactgccacccctaagcccctccagcctttgggt
tgtatctcacagtcactctcacctagtaagaaggcactgtctccacaagtagaaccactc
tggccccaaaggctatggaataactcagaaccaaattcagctggccccacagaatacctt
tccccagatatgcaacaccagcgaaagactaagcggaaaaccaaagaacagttggccatc
ctcaaatcctttttcctacagtgccaatgggcacgacgagaagattaccataaattagaa
cagatcactggtttacctcgcccggagatcattcaatggtttggtgacacacgatatgcc
ttgaagcatggacagctgaaatggtttcgggacaatgcagtacttggtacccctagtttt
caagatccagccattcctacaccttcaactcgttccttgaaagaatgggccaagacacca
cctctaccagccccaccgcccccaccagatatacgacctttggagaagtactgggcagcc
caccagcagctgcaggaagctgatatccttaaactgagtcaggcatcacgactaagcact
cagcaagtgttggactggtttgactctcgattgcctaagccagcagaagtggtagtttgt
ctagatgaagaagacgaggaggatgaggaggatgaactgccagaagatggtgaggaagag
gaggaggaggaggaagatgatgatgatggtgatgatgatgtcatcatatgggactga

DBGET integrated database retrieval system