KEGG   Mus musculus (house mouse): 239126
Entry
239126            CDS       T01002                                 
Symbol
C1qtnf9, 9130217G22Rik, Adif1, CTRP9, Ciqtnf9
Name
(RefSeq) C1q and tumor necrosis factor related protein 9
  KO
K24213  complement C1q and tumor necrosis factor-related protein 9
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    239126 (C1qtnf9)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   239126 (C1qtnf9)
SSDB
Motif
Pfam: C1q Collagen BclA_C DUF1923
Other DBs
NCBI-GeneID: 239126
NCBI-ProteinID: NP_898998
MGI: 3045252
Ensembl: ENSMUSG00000071347
UniProt: Q4ZJN1
Position
14:61005583..61018318
AA seq 333 aa
MRIWWLLLVMGACTRSVFSQDTCRQGHSGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGH
PGGPGKDGIRGEKGEPGADGRVEAKGIKGDPGSRGSPGKHGPKGSIGPTGEQGLPGETGP
QGQKGDKGEVGPTGPEGLMGSTGPLGPKGLPGPMGPIGKPGPRGEAGPMGPQGEPGVRGM
RGWKGDRGEKGKVGEAPLVPKSAFTVGLTVISKFPPPDAPIKFDKILYNELNHYNVATGK
FTCHVAGVYYFTYHITVFSRNVQVSLVKNGVKVLHTKDSYMSSEDQASGGIVQELKLGDE
VWMQVTGGERFNGLFADEDDDTTFTGFLLFSSS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaggatttggtggcttctgctggttatgggtgcatgcacgagaagtgtattctcccag
gacacctgccggcaagggcactccggcatccctgggaatccaggtcacaatggcctacct
ggaagagatggacgagatggtgccaagggtgacaaaggagacgcaggagaaccaggacat
cctggtggtccaggaaaggatggaattcgtggggagaaaggagaaccaggagcagatgga
agagttgaagcaaaaggcatcaaaggtgatccaggctccagaggatctccggggaaacat
ggcccaaagggatccattggtcctacaggagagcaagggctgccaggagagactggccct
caggggcagaagggggataaaggcgaagtgggccccactggacccgaaggactaatgggc
agtactggtcctttgggtcccaagggcttacctggcccgatgggccccatcggcaaacca
ggtcccaggggagaagctggacccatgggcccccagggggagccaggagtcagaggaatg
agaggctggaaaggcgatcgaggagagaaggggaaagttggtgaggctccccttgtgccc
aagagtgctttcactgtgggactcacggtgatcagtaagttccctcccccagatgcaccc
attaaattcgataagatcctatacaatgaactgaaccactacaatgtagcgacggggaag
ttcacctgccacgtggcaggtgtctattactttacctaccatatcactgtgttctccagg
aatgtgcaggtatctttggtcaaaaacggggtaaaagtcctgcacaccaaggacagttac
atgagctctgaggaccaggcgtctggtggcattgtgcaggagctgaaactcggggacgaa
gtgtggatgcaggtgacaggaggagagaggttcaatggcttatttgcagacgaggatgac
gataccacgttcacgggcttcctgctgttcagcagctcttga

DBGET integrated database retrieval system