KEGG   Mus musculus (house mouse): 239133
Entry
239133            CDS       T01002                                 
Symbol
Dleu7, BC038059
Name
(RefSeq) deleted in lymphocytic leukemia, 7
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DLEU7 Pox_I6
Other DBs
NCBI-GeneID: 239133
NCBI-ProteinID: NP_775595
MGI: 2447771
Ensembl: ENSMUSG00000048281
UniProt: Q8CHZ8
Position
14:complement(62513678..62530428)
AA seq 209 aa
MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPSAPGSPRGPDHVPIAQARRPGQLRTR
RGLGRGSIGARGSPEAGGLRGAEGGAELLPFPRDRGPCTLARMAMRSALARVVDSTSELV
SVEQTLLGPLQQERPFPVHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKL
IQSLANLPSDAHVVACASLRQILQNLPDV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggccagccctgcgcccttagtggcttccatcagccaccaaatggtggctctgcagacc
ctgcagctactacagcaggagtggggctggggcgacggtcctagcgccccagggagcccg
cgcggcccggaccacgtgcccatcgcccaggctcgtcgcccaggccagctgcggacccgg
agggggctgggacgcgggagcatcggagcgcggggatcccccgaggcaggcgggctgcgg
ggcgcagaggggggcgccgagctgctgcctttcccccgggaccgcgggccctgtaccttg
gcgcggatggcgatgcgcagcgctctggctcgggtggtggactcgacctcggagctggtc
agcgtagagcagactctgcttgggcctctccagcaggagcggcccttccctgtccacctg
aaggatagcgtggaatttagaaacatctgcagtcacttggctctgcagattgaaggacag
cagtttgacagagacttgaatgccgctcaccagtgtctgaaaaccatagtgaagaagttg
atccagtcacttgctaatctcccatcagatgcccacgtggttgcctgcgcttccttgaga
cagatcttacagaatctcccagatgtatga

DBGET integrated database retrieval system