KEGG   Mus musculus (house mouse): 239134
Entry
239134            CDS       T01002                                 
Symbol
Gucy1b2, B930025B03, GC-SB2
Name
(RefSeq) guanylate cyclase 1, soluble, beta 2
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04730  Long-term depression
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    239134 (Gucy1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    239134 (Gucy1b2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    239134 (Gucy1b2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    239134 (Gucy1b2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    239134 (Gucy1b2)
   04924 Renin secretion
    239134 (Gucy1b2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    239134 (Gucy1b2)
  09154 Digestive system
   04970 Salivary secretion
    239134 (Gucy1b2)
  09156 Nervous system
   04730 Long-term depression
    239134 (Gucy1b2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    239134 (Gucy1b2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     239134 (Gucy1b2)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 239134
NCBI-ProteinID: NP_001191269
MGI: 2660873
Ensembl: ENSMUSG00000021933
UniProt: E9Q6H0
Position
14:complement(62610384..62693745)
AA seq 809 aa
MVMSEVLCAEYTLKVKMSDTADGVLYEPLRAEFRSKRTHLQGSAEGRGQFLASLQSTSTA
FQRFGKTPGVQLRPGDTTLDTMYGFINTCLQSLVTEKFGEETWEKLKASAEVQDVFMTYT
VYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENL
DALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDV
AMSILDMNEEVERTGKKEHVVFLVVQKARRQIRGAKSLQGTLLRKKERYLSIPVCPGEKS
HSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQK
YVPGILTQKFGLDEYFSIVHPQVTFNISSICKFINSQFILKTRREMMPEAWKSQPTLKLR
GQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSC
QLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDV
VTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQ
RVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASR
MESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFLIRNLNATEVEIMGR
PSALADGKEASTPRNQVKKPRAVLSNMDHHQQQVYNSDPADASDEVTLAGSPVAGRDDTD
AVNSQSSPDETKTSAFASDPVLSAFCAVL
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggtgatgtctgaagtgttgtgtgctgagtatacgctaaaagttaaaatgtcagacaca
gcagacggtgtgctgtatgagcctctgcgagcggagtttaggagcaagcgaacccatcta
cagggctcagcagaaggccgaggtcagttcctagcttcactgcagagcacctcaactgcc
ttccagagattcggtaagacgccgggtgtgcagctccggcctggagacacgacgctggac
accatgtacggatttatcaacacctgtctgcagtctcttgtgacagagaaatttggagag
gagacgtgggaaaagctaaaggcttctgcagaagtgcaagatgtcttcatgacctacacc
gtgtatgatgataccatcaccgttaagctcatccaagaagcctgcaaggctctggatgtt
tccatggaagccattctgaagctctttggcgaatacttctttaagttctgtaagatgtcc
ggctatgacaggatgctacggacacttggaggaaatctcacagagtttattgaaaatcta
gatgccctccacagttacctggcactgtcctatcaggaaatgaacgcaccgtcctttcga
gtggagggaggagcagacggggcaatgcgtctccattactactcagacagacgtggtctg
tgtcacatcgtaccaggcatcattgaagctgtggccaaggacttctttgacactgatgtg
gccatgagtatccttgatatgaatgaagaggtggaaaggacagggaagaaagaacatgtc
gtgttccttgttgtgcagaaggctcgaagacagataagaggggcaaagtctcttcaggga
acactccttaggaagaaggagaggtatttaagcatccctgtttgccctggggagaaatct
cactcagctgttgtgagggcatcagtcctgcttggaaaagggccccttggggacaccttc
cagcctgtctttcctgagagactgtggattgaagaggaggtgttctgcaatgcttttcct
ttccacgttgtctttgacgaagcactaagggtcaagcaagctggagtgaatattcagaag
tatgtccctggaatcttgacccagaagtttggtctagatgagtatttctccatcgtccac
cctcaagttactttcaacatctccagcatctgcaagttcattaacagtcagtttatcttg
aagacacgaagagagatgatgcccgaagcatggaagagccagccgacactcaaactccgg
ggtcagatgatctggatggagtctctgaagtgcatggtcttcatgtgttctccaaagctc
cgcagcctgcaagagctggaggagagcaagatgcatctttccgacatcgctccccacgac
acgaccagggatctcatcctcctcaaccagcagaggctggcagagatggaactgtcctgc
caactggagaagaagaaggaggagttgcgtgtcctttccaatcacctggccattgaaaag
aagaagacagagaccttgctgtatgccatgctgcctgaacatgtggccaaccagctcaag
gagggcaaaaaggtggcggcaggagaattcgagacgtgtaccatccttttcagcgatgtt
gtgacattcaccaacatctgtgcggcctgtgaacctatccaaatagtgaacatgctcaac
tcaatgtactccaagtttgacaggttaaccaacatccatgatgtctataaagtagaaaca
ataggtgatgcttacatggtggtaggtggagtaccagtacccgttgaaagccatgctcaa
agagttgctaattttgctctggggatgagaatttctgcaaaagaagtgatgaatcctgtc
actggggaacccatacagatcagagtgggaatccatactggaccagtcttagcaggtgtt
gtgggagacaagatgccccggtactgcctgtttggtgacaccgtaaacacggcctctagg
atggaaagtcacgggcttcccaacaaagtgcatctgagccccacagcccacagggctctg
gaaaacaaagggtttgaaattgtcacgagaggggagatagaggtgaaggggaaaggaaaa
atgaccacatacttcctgatccggaacctgaatgccaccgaggttgagatcatggggcga
ccttcagctctcgctgatgggaaggaagcaagtactcctagaaaccaagtcaagaagccc
cgtgctgtcctgagcaacatggaccaccaccagcagcaagtctacaacagtgatccagca
gacgcttctgatgaagtcacacttgctgggagtccagtggcagggcgagacgacacagat
gcagtcaatagccagtcatcaccagatgagaccaagacaagtgcctttgccagtgaccct
gtgttgtctgccttctgtgctgtgttgtga

DBGET integrated database retrieval system