KEGG   Mus musculus (mouse): 23921
Entry
23921             CDS       T01002                                 

Gene name
Sh2b2, Aps
Definition
(RefSeq) SH2B adaptor protein 2
  KO
K07193  SH2B adapter protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    23921 (Sh2b2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    23921 (Sh2b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    23921 (Sh2b2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   23921 (Sh2b2)
SSDB
Motif
Pfam: Phe_ZIP PH SH2
Other DBs
NCBI-GeneID: 23921
NCBI-ProteinID: NP_001289867
MGI: 1345171
Ensembl: ENSMUSG00000005057
Vega: OTTMUSG00000054381
UniProt: Q9JID9
Structure
PDB: 
1V5M

Position
5; 5 G2
AA seq 621 aa
MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHF
AANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARV
RKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAA
KVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRP
KVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDP
GDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVG
ESLAHVPLETFLQTLESSGGVSENNNPGDEGAELDTDAEAELELSDYPWFHGTLSRVKAA
QLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVF
DMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFS
SLATATCPPASPSNGAGASSSSGSSSSATSLPPRPAEGPLSAHSRSNSTEHLLDAASGAT
EEPTEATLGRARAVENQYSFY
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgaatggtgccacccccagctcggccgccgcccccgccccagtccccgactggcggcaa
ttctgcgagctgcacgcgcaggtggctgctgtggacttcgcacacaagttctgccgcttc
cttcgggacaacccgacctacgacacgcctgacgctgggacctcattctcccgccacttt
gcagccaacttcttggctgtcttcagtgaggaggtgcgccgcgtgctggggtcagcagcc
gacactatggaacccgagcctgcggtgacctcggtgacatctgcgctcaagactgcaacc
tatggccactcccgcagctccgaggatgtgtctgcccacgcggctaccaaggcgcgtgtc
cgaaagggattctcgctgcgtaacatgagcctgtgtgtggtggatggagtgcgcgacctg
tggcaccggcgctcgtccccagagcccgatggtggggccacccccaaggccgccgagcct
gcgtcggagcctcgtgacaaatggacgcgacgcctgcggctagcacgaaccctggcagcc
aaagtggagttagtggacatccagcgtgagggcgccctgcgcttcatggtggcagacgac
gcggcctcagggcctggaggcactgcgcagtggcagaagtgtcgcctgctcctgcggagg
gctgtggctggggaacgtttccgcctggagttcttcgtgccacccaaggcttccagaccc
aaggtcagcatccccctgtcggccatcattgaggtccgaaccactatgcccctggaaatg
cctgaaaaggacaacacatttgtgctcaaggtggagaacggagcagaatacatcctggaa
acgatagactcactgcagaagcactcgtgggtggctgacatccagggctgtgtggatcct
ggggacagtgaggaagacacaggactgtcttgtgcacggggaggctgcctggccagccgc
gtggcctcctgcagctgtgagctcctgacagatgcagacatgccccggccccccgagacg
acgacagcggtgggtgctgtggtcacagctccacatggccgagctcgtgacaccgtggga
gagtccctggcccacgttcccctggagactttcctgcaaaccctggagtcttcaggtggt
gtcagtgagaacaataacccaggggacgaaggagctgagctggacaccgatgctgaggct
gagctggaactttccgactacccctggttccatgggacattgtcccgggtgaaggcggcc
cagcttgtgctggccggtggccctcggagccatggcctctttgtgatccgccaaagtgag
actaggcctggggagtgtgtgctgaccttcaacttccagggcaaggccaagcacctccgc
ctttctctgaacggtcacggccagtgtcatgtccagcacctgtggttccagtccgtgttt
gatatgctccgtcacttccacacccaccccatccccctggagtcaggaggatcggctgat
atcaccctaagaagctatgtgcgtgcccagggcccgcctcctgatccaggaccagcgccc
aacactgcggccccagttccagcctgctggacggagccggctggccagcactacttctcc
agcctggccacggccacttgcccgcccgcttcaccgtccaatggcgctggagcttcgtct
tcatccggctcatcgtcctctgccacatccctgcccccacgcccagccgaggggccgctc
agtgcgcacagccgcagcaacagcacagagcacctgctggatgctgcatctggagccact
gaggagcccacagaggccacgctgggccgtgctcgtgctgtggagaatcagtactccttt
tactag

DBGET integrated database retrieval system