KEGG   Mus musculus (mouse): 23922
Entry
23922             CDS       T01002                                 

Gene name
Jtb, Gm622
Definition
(RefSeq) jumping translocation breakpoint
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: JTB DUF1505
Other DBs
NCBI-GeneID: 23922
NCBI-ProteinID: NP_996807
MGI: 1346082
Ensembl: ENSMUSG00000027937
Vega: OTTMUSG00000021952
UniProt: O88824 Q542D4 Q9D0T9
Position
3; 3 F1
AA seq 146 aa
MLAGAGRRGLPRAGHLCWLLCAFTLKLCEAEAPVREEKLSVSTSTSPCWLAEEFVVTEEC
TPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVF
ACLVIVRQRQLDRKALEKVRKQIESI
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctcgcgggcgcggggaggcgtggcctcccccgggccggccacctctgttggctgctg
tgcgctttcaccttaaaactctgcgaggcagaggctccggtgcgcgaggagaagctatca
gtgagcacttcaacttcgccatgttggttggcagaagagtttgtggtgactgaagagtgt
actccgtgttctaacttccagattaaaacaacacctgagtgtggttctacagggtatgtg
gaaaaaatcacatgcagctcatctaagaggaatgaattcaaaagctgccgttcggctcta
ctggaacaacacttattctggaaatttgaaggcgttgtggtggctgtagctttagtcttc
gcctgccttgtcatcgttcgtcagcgacaactggacagaaaggctcttgaaaaagtcagg
aagcaaattgagtccatatag

DBGET integrated database retrieval system