KEGG   Mus musculus (house mouse): 23924
Entry
23924             CDS       T01002                                 
Symbol
Katna1
Name
(RefSeq) katanin p60 (ATPase-containing) subunit A1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    23924 (Katna1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     23924 (Katna1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     23924 (Katna1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Vps4_C RuvB_N AAA_2 AAA_33 AAA_5 TIP49 Mg_chelatase AAA_7 AAA_16 AAA_22 IstB_IS21 AAA_14 TsaE AAA_18 PhoH RNA_helicase TPR_1 ABC_tran TPR_8 DUF5906 AAA_28 AAA_24 Sigma54_activat NACHT Sigma54_activ_2 AAA_17
Other DBs
NCBI-GeneID: 23924
NCBI-ProteinID: NP_035965
MGI: 1344353
Ensembl: ENSMUSG00000019794
UniProt: E9PZI6
Structure
Position
10:7601748..7638914
AA seq 491 aa
MSLQMIVENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTHLRQKWQQVWQEIN
VEAKQVKDIMKTLESFKLDITSLQAAQHEFPAAEGEVWSLPVPVERRPLPGPRKRQSSQH
SDPKPHSNRPSTVVRAHRPSPQNLHNDRGKAVRSREKKEQSKGREEKNKLPAAVTEPEAN
KFDGTGYDKDLVEALERDIISQNPNVRWYDIADLVEAKKLLQEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRMKAELLVQMDGVGGASENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSREAMHMPTTMEDFEMALKKISKSVSAADIER
YEKWIVEFGSC
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgagtcttcaaatgattgttgagaatgtaaaattggctcgtgaatatgcactgctggga
aactatgactctgcaatggtctactatcagggagttcttgaccaaatgaacaagtacctg
tactcagtcaaagatacacacctccgtcagaaatggcaacaggtttggcaggaaataaat
gtggaagctaagcaagttaaggatatcatgaaaacactcgagagcttcaaactagacatc
acttctttgcaagctgcacaacatgaatttccagctgctgaaggagaagtctggtccttg
cctgtacctgttgagcgaagacccttaccaggacctaggaaacgccagtcttctcagcac
agtgaccctaagccacacagtaaccggccaagcacagtcgtcagagctcatcggccgtct
ccacagaatcttcacaatgacagagggaaagctgttcgtagtcgtgaaaagaaagaacag
agtaagggaagagaggaaaagaacaaattacctgctgcagttacagaaccagaggcaaat
aagtttgatggcactgggtatgacaaggacttagtagaagctttggaaagagatatcatt
tctcagaatcccaacgttcggtggtatgatattgctgatttagtagaagccaaaaagttg
cttcaggaagcagtggtgttaccaatgtggatgccagaattctttaagggcattaggaga
ccatggaaaggtgtgctgatggttggcccacctggcactggaaagacccttctagctaaa
gcagttgccacggaatgcaagacaacgttcttcaatgtctcttcatcaactctgacgtcc
aaatacagaggagagtctgagaagcttgtccgtcttctgtttgaaatggctcggttttac
tccccagctaccatatttattgatgagatagattccatttgcagccgccgaggaacttct
gaagagcatgaagccagccgaaggatgaaagctgagctgctggttcaaatggacggtgtt
ggaggtgcctcagagaacgatgacccttccaaaatggttatggttctggcggctactaat
ttcccatgggacatagatgaggctttaaggcgtcgtctggagaaaagaatctatattcca
ttaccatcagcaaaaggcagggaagaactgttgagaataagtctgcgagagctggaattg
gctgatgatgtcaaccttgcgagcatagcagaaaacatggaaggctactcgggtgcagac
attaccaatgtatgcagggacgcatcgttgatggccatgagacggcgtattgagggtcta
accccagaagaaatccggaacctttcaagagaagcaatgcacatgcctaccaccatggag
gattttgaaatggctttaaagaagatttctaaatcagtatcagctgcagatattgaaaga
tacgagaaatggatagttgagtttggatcatgctag

DBGET integrated database retrieval system