KEGG   Mus musculus (mouse): 23924Help
Entry
23924             CDS       T01002                                 

Gene name
Katna1
Definition
(RefSeq) katanin p60 (ATPase-containing) subunit A1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     23924 (Katna1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     23924 (Katna1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Vps4_C RuvB_N AAA_2 AAA_33 AAA_5 IstB_IS21 TIP49 Mg_chelatase AAA_7 AAA_16 AAA_22 AAA_14 TsaE PhoH AAA_18 RNA_helicase TPR_1 ABC_tran TPR_8 Carbpep_Y_N Sigma54_activat NACHT Guanylate_kin
Motif
Other DBs
NCBI-GeneID: 23924
NCBI-ProteinID: NP_035965
MGI: 1344353
Ensembl: ENSMUSG00000019794
Vega: OTTMUSG00000035234
UniProt: E9PZI6
Structure
PDB: 

Position
10; 10 A1
AA seq 493 aa AA seqDB search
MTMSLQMIVENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTHLRQKWQQVWQE
INVEAKQVKDIMKTLESFKLDITSLQAAQHEFPAAEGEVWSLPVPVERRPLPGPRKRQSS
QHSDPKPHSNRPSTVVRAHRPSPQNLHNDRGKAVRSREKKEQSKGREEKNKLPAAVTEPE
ANKFDGTGYDKDLVEALERDIISQNPNVRWYDIADLVEAKKLLQEAVVLPMWMPEFFKGI
RRPWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMAR
FYSPATIFIDEIDSICSRRGTSEEHEASRRMKAELLVQMDGVGGASENDDPSKMVMVLAA
TNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVNLASIAENMEGYSG
ADITNVCRDASLMAMRRRIEGLTPEEIRNLSREAMHMPTTMEDFEMALKKISKSVSAADI
ERYEKWIVEFGSC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagtcttcaaatgattgttgagaatgtaaaattggctcgtgaatatgcactg
ctgggaaactatgactctgcaatggtctactatcagggagttcttgaccaaatgaacaag
tacctgtactcagtcaaagatacacacctccgtcagaaatggcaacaggtttggcaggaa
ataaatgtggaagctaagcaagttaaggatatcatgaaaacactcgagagcttcaaacta
gacatcacttctttgcaagctgcacaacatgaatttccagctgctgaaggagaagtctgg
tccttgcctgtacctgttgagcgaagacccttaccaggacctaggaaacgccagtcttct
cagcacagtgaccctaagccacacagtaaccggccaagcacagtcgtcagagctcatcgg
ccgtctccacagaatcttcacaatgacagagggaaagctgttcgtagtcgtgaaaagaaa
gaacagagtaagggaagagaggaaaagaacaaattacctgctgcagttacagaaccagag
gcaaataagtttgatggcactgggtatgacaaggacttagtagaagctttggaaagagat
atcatttctcagaatcccaacgttcggtggtatgatattgctgatttagtagaagccaaa
aagttgcttcaggaagcagtggtgttaccaatgtggatgccagaattctttaagggcatt
aggagaccatggaaaggtgtgctgatggttggcccacctggcactggaaagacccttcta
gctaaagcagttgccacggaatgcaagacaacgttcttcaatgtctcttcatcaactctg
acgtccaaatacagaggagagtctgagaagcttgtccgtcttctgtttgaaatggctcgg
ttttactccccagctaccatatttattgatgagatagattccatttgcagccgccgagga
acttctgaagagcatgaagccagccgaaggatgaaagctgagctgctggttcaaatggac
ggtgttggaggtgcctcagagaacgatgacccttccaaaatggttatggttctggcggct
actaatttcccatgggacatagatgaggctttaaggcgtcgtctggagaaaagaatctat
attccattaccatcagcaaaaggcagggaagaactgttgagaataagtctgcgagagctg
gaattggctgatgatgtcaaccttgcgagcatagcagaaaacatggaaggctactcgggt
gcagacattaccaatgtatgcagggacgcatcgttgatggccatgagacggcgtattgag
ggtctaaccccagaagaaatccggaacctttcaagagaagcaatgcacatgcctaccacc
atggaggattttgaaatggctttaaagaagatttctaaatcagtatcagctgcagatatt
gaaagatacgagaaatggatagttgagtttggatcatgctag

DBGET integrated database retrieval system