KEGG   Mus musculus (house mouse): 23927
Entry
23927             CDS       T01002                                 
Symbol
Krtap14, Pmg1, mKAP13
Name
(RefSeq) keratin associated protein 14
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PMG Keratin_B2_2 Keratin_B2 AZUL
Other DBs
NCBI-GeneID: 23927
NCBI-ProteinID: NP_038735
MGI: 1346079
Ensembl: ENSMUSG00000074928
UniProt: O08640
Position
16:complement(88622179..88623033)
AA seq 167 aa
MSCNSCSGTFSQSFGGQLQYPISSCGSSYPNNVFYSTDLQTPITHQLGSSLHSGCQETFC
EPTNCQTAYVVSRPCQRPFYSQRIRGPCRPCQSTFSGSLGFGSRGFQSFGCGYPSQGFGS
HGFQSVGCGTPTFSSLNCGSSFYRPTCFSTKSCQSVSYQPTCGTGFF
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcctgcaacagctgctctggaactttctcccagtcctttgggggccaactgcagtat
ccgatctcttcatgcggttcctcctaccccaacaacgtcttctacagcactgacctccaa
actcccatcacccaccagctgggctcttctcttcacagtgggtgccaggaaaccttctgt
gagcccaccaactgccagacagcctatgtggtctccagaccctgccagaggcctttctac
agtcagaggattcgagggccctgcaggccctgccagtcaactttctcgggatccctggga
tttggttccaggggtttccagtcttttggctgtggctacccatcccagggctttggatcc
catggtttccagtcagtaggatgtggtacccctactttctcatccctaaattgtggatcc
agcttttaccgcccaacctgcttctctaccaaaagctgccagtctgtttcttatcagcca
acctgtgggactggcttcttctga

DBGET integrated database retrieval system