KEGG   Mus musculus (mouse): 23928Help
Entry
23928             CDS       T01002                                 

Gene name
Lamc3, 1110064A23Rik, AI562206, AW240805
Definition
(RefSeq) laminin gamma 3
  KO
K06247  laminin, gamma 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23928 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    23928 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23928 (Lamc3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    23928 (Lamc3)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    23928 (Lamc3)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    23928 (Lamc3)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    23928 (Lamc3)
   05145 Toxoplasmosis
    23928 (Lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 23928
NCBI-ProteinID: NP_035966
MGI: 1344394
Ensembl: ENSMUSG00000026840
Vega: OTTMUSG00000012245
UniProt: Q9R0B6
Position
2; 2 B
AA seq 1581 aa AA seqDB search
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSERALLASNASYE
LLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATVKQVIGDAAPHL
GLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRALEKMEPFMQLRN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatccagggtcctgtccctcctggcaacggtggcatcgatggcgctggtgatt
caggagacacacttcgcggcaggcgcggacatgggctcttgctacgacggtgtgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgaccccggacgacgccacgacgcctcctacctc
acagacttccacagccccgatgacagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctctgttaacctgaccttgagcttagggaaggcctatgagattacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgaacgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacatcctgatctctctagatcggctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgaatgcgaacccaatgcggctggtcagctggcttgccgc
tgtcagcacaacaccacaggagtggactgcgagcgttgtctgcccttcttccaggaccgt
ccgtgggcccgaggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacaggccatggtgggcac
tgtcagcggtgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactac
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcaggcgtctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtgcc
tgcaatgtcgccggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccctgggacatttaacctgcagccc
cacaatccagtgggctgcagcagctgcttctgttatggccactccaaggtgtgttctcct
gctgccgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cagatcagaagcatgggagtgtccaagcgtcctctgcaatggagccagagtgggctcctc
ctgggcctgcgaggaggggaggaactctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccccacct
cctattcagctgagactggagggagcaggcttggctctgtctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcctggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ctgggatacaagagagaaatacctcatgggggtccctatgccaactgcattccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaacgccttctcaggccgt
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgcgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
cgatgccagtgcagcgggaacgtggatctcaatgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtcgggag
ggtttctacgggagtgccgtggccacaaggcccgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccgctgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacctggtgtcactggccaagcctgtgacaga
tgccagctaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ttgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcccggcttt
gtgggctataaatgcgaccgctgccaggacaatttcttcctcgcggatggcgacacaggc
tgccaagagtgtcccacttgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggttgatgctgatggaggggtggcttcaaaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagagacccgggggaccttcctgcagcagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaggaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcacaccc
accaattggagtcacctggcatcagaggcccagatccttgccagaagccacagggacacg
gccaccaagatcgaagctacctcggaaagggccctgctcgcctccaacgccagctatgag
ctcctgaagctgatggaaggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctgccc
aaagctgaaaaggcactggccacggtgaagcaagtcattggtgacgcagccccacatcta
ggcttgctggtcacccctgaagcaatgaacttccaagccaggggcctgagctggaaagtg
aaggccctggagcagaagctggagcagaaggagcccgaggtgggccagtctgtgggagcc
ctgcaggtggaggctggaagagccttggagaagatggagccctttatgcagctacgcaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
agcaccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgactcgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaagctaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagcttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgaccttgctgag
atccgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

DBGET integrated database retrieval system