KEGG   Mus musculus (mouse): 239318Help
Entry
239318            CDS       T01002                                 

Gene name
Plcxd3, B130016O10Rik
Definition
(RefSeq) phosphatidylinositol-specific phospholipase C, X domain containing 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X Varsurf_PPLC
Motif
Other DBs
NCBI-GeneID: 239318
NCBI-ProteinID: NP_796329
MGI: 2442605
Ensembl: ENSMUSG00000049148
Vega: OTTMUSG00000027967
UniProt: Q8BLJ3 G3X9A7
Position
15; 15 A1
AA seq 321 aa AA seqDB search
MASSQGKNELKFADWMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMSFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWIRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFNEGEANT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcctcatctcaggggaaaaacgagctgaaattcgccgactggatggcaactctgcct
gagagcatccacagcatccccctcaccaatttagccatcccagggtcccatgattccttc
agcttctacattgatgaagcttctccagtaggcccggagcagccagaaacagttcaaaac
tttgtctctgtgttcggaactgtagccaagaagttgatgcggaaatggttagccactcag
acgatgagcttcactggtcagctgggagctggaatccgttacttcgaccttcgaatttcc
accaagcccagagacccagacaatgaactgtattttgctcacggcttattcagtgccaaa
gtcaacgagggtctcgaagagatcaatgcatttctcacagaccaccacaaagaggtagta
ttcttggacttcaaccatttttatgggatgcaaaaatatcaccatgaaaaactggtccaa
atgctgaaagacatctatggaaacaagatgtgcccagccatttttgcccaggaagtgagt
ctaaagtacctatgggagaaggactatcaagtactggtcttctaccacagtccagtggca
ctggaagtgcccttcctctggcctggacagatgatgccagcaccctgggcaaacacgaca
gacccagagaaattgatccagtttcttcaggcatccatcaccgagagaagaaagaagggc
tcattttttatatctcaggtggtgctgacacccaaagcaagcactgtggtcaagggtgtg
gcaagtggactcagagaaacaatcacagagagagctcttcccgccatgatgcagtggatc
cgtacccaaaagccaggagagagcggcatcaatattgtcactgccgattttgtagaactt
ggtgactttatcagcactgtcataaaactcaactatgtcttcaatgaaggagaggccaac
acttga

DBGET integrated database retrieval system