KEGG   Mus musculus (mouse): 23937Help
Entry
23937             CDS       T01002                                 

Gene name
Mab21l2
Definition
(RefSeq) mab-21-like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Mab-21
Motif
Other DBs
NCBI-GeneID: 23937
NCBI-ProteinID: NP_035969
MGI: 1346022
Ensembl: ENSMUSG00000057777
UniProt: Q8BPP1
Position
3; 3 F1
AA seq 359 aa AA seqDB search
MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEID
ARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS
GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIW
PRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQSSAESDAWVLQFGEAENR
LLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRL
NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREILTNPKSLDKL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgctcaggccaagctggtttaccagctcaataaatactacaccgagcgctgc
caggcgcgcaaggctgcgatcgccaagaccatccgagaagtctgcaaggtagtgtcggat
gtgctaaaggaagtggaggtgcaagagccccgcttcatcagctctctgagtgagattgac
gcccgctacgaggggctggaggtaatctcgcccaccgagttcgaggtggtactctacctc
aaccagatgggagtcttcaacttcgtggacgacggatctctgcccggctgtgccgtgctc
aaactaagcgatgggcggaagcggagcatgtctctttgggtcgagttcatcacagcgtct
ggctacctttctgcgcgcaagatccgctcgcgtttccagacactagtagcccaggcggtg
gacaagtgcagctaccgggacgtggtcaagatgatcgccgacactagtgaggtcaagttg
cgcatcagggagcgctacgtggtgcaaatcaccccagcgttcaagtgcaccgggatctgg
cctcgcagcgcggcacagtggcctatgccccacatcccctggcccggccccaatcgggtg
gcggaggtcaaggccgaagggttcaacttgctctccaaggagtgctactcgctgactggc
aagcagagctccgcagaaagcgacgcctgggtgctgcagttcggtgaggcggagaaccgc
ttgctgatgggcggctgtagaaacaagtgcctctcggtgctgaagacgctgcgggaccgc
cacctggagctgcctggccagccgctcaataactaccacatgaagacgctgctgctgtac
gagtgcgagaaacacccgagggaaacggactgggacgaggcttgcttgggcgaccgtctg
aacggcatcctgctacagctcatctcctgcctgcagtgccgccgctgccctcactacttt
ttgcccaacctcgacctcttccagggtaagccccactcggccctggagagcgctgccaag
cagacctggagattggccagggaaatcctcaccaatcccaaaagcttggacaaactatag

DBGET integrated database retrieval system