KEGG   Mus musculus (mouse): 23938Help
Entry
23938             CDS       T01002                                 

Gene name
Map2k5, AI324775, AI428457, MEK5, Mapkk5, Prkmk5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04540  Gap junction
mmu04722  Neurotrophin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23938 (Map2k5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    23938 (Map2k5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    23938 (Map2k5)
  Nervous system
   04722 Neurotrophin signaling pathway
    23938 (Map2k5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    23938 (Map2k5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     23938 (Map2k5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   23938 (Map2k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 23938
NCBI-ProteinID: NP_035970
MGI: 1346345
Ensembl: ENSMUSG00000058444
Vega: OTTMUSG00000062570
UniProt: Q9WVS7
Structure
PDB: 

Position
9; 9 B-C
AA seq 448 aa AA seqDB search
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTV
YKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTGGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNSTVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctggcccttggccccttctgtgccatggagaaccaggtgctggtgattcgg
atcaagattccaaatagtggcgcggtggactggaccgtgcactccgggccgcagttactc
ttcagggatgttctggatgtgataggccaggttctgcctgaagcgacgacgacagcgttt
gaatatgaagatgaagatggtgataggattacagtaagaagcgatgaagagatgaaggca
atgctgtcctactattattccacagtaatggaacagcaagtaaatggccagctaatagag
ccgctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacacgggctgggccatctcaacacaccagccctgtggtctcagattcgctt
ccaagcaatagcttgaagaagtcctcagctgaactgagaaagatactggccaacggccag
atgaatgaacaagacatacggtatcgagacacccttggtcatggcaacggaggcacagtc
tacaaagcacatcatgtcccaagtgggaaaattttagctgtaaaggttattctgttagac
attacactggagcttcagaagcagatcatgtctgagctggaaatcctttataagtgtgac
tcatcgtatatcataggattttacggggcatttttcgtagaaaacaggatttcaatttgt
acagaattcatggatggggggtctttggatgtatataggaaaattccagagcacgtcctt
ggaagaattgcagttgcagttgttaaaggccttacctatctgtggagtttaaagatttta
cacagagatgtgaagccctccaacatgcttgtaaacacaggcggacaggtcaagctgtgt
gactttggcgtgagcacacagctggtgaattctatagccaagacgtatgttggaacaaat
gcttacatggcaccagaaagaatttcaggagagcagtatgggatccattctgacgtgtgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
ccggtccttccgcttggagagttctcggagccgtttgtacatttcatcactcagtgcatg
aggaagcagcccaaggagagaccggcgcctgaggagctgatgggtcacccattcatcgtg
cagttcaatgatggaaactccactgtggtgtccatgtgggtgtgccgagctctagaggag
aggcggagccagcagggacccccgtga

DBGET integrated database retrieval system