KEGG   Mus musculus (mouse): 23938
Entry
23938             CDS       T01002                                 

Gene name
Map2k5, AI324775, AI428457, MEK5, Mapkk5, Prkmk5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04540  Gap junction
mmu04722  Neurotrophin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23938 (Map2k5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    23938 (Map2k5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    23938 (Map2k5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    23938 (Map2k5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    23938 (Map2k5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    23938 (Map2k5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     23938 (Map2k5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   23938 (Map2k5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 ABC1 Pkinase_fungal Kinase-like APH
Other DBs
NCBI-GeneID: 23938
NCBI-ProteinID: NP_035970
MGI: 1346345
Ensembl: ENSMUSG00000058444
Vega: OTTMUSG00000062570
UniProt: Q9WVS7
Structure
PDB: 
1WI0

Position
9; 9 B- C
AA seq 448 aa
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTV
YKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTGGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNSTVVSMWVCRALEERRSQQGPP
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgtggctggcccttggccccttctgtgccatggagaaccaggtgctggtgattcgg
atcaagattccaaatagtggcgcggtggactggaccgtgcactccgggccgcagttactc
ttcagggatgttctggatgtgataggccaggttctgcctgaagcgacgacgacagcgttt
gaatatgaagatgaagatggtgataggattacagtaagaagcgatgaagagatgaaggca
atgctgtcctactattattccacagtaatggaacagcaagtaaatggccagctaatagag
ccgctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacacgggctgggccatctcaacacaccagccctgtggtctcagattcgctt
ccaagcaatagcttgaagaagtcctcagctgaactgagaaagatactggccaacggccag
atgaatgaacaagacatacggtatcgagacacccttggtcatggcaacggaggcacagtc
tacaaagcacatcatgtcccaagtgggaaaattttagctgtaaaggttattctgttagac
attacactggagcttcagaagcagatcatgtctgagctggaaatcctttataagtgtgac
tcatcgtatatcataggattttacggggcatttttcgtagaaaacaggatttcaatttgt
acagaattcatggatggggggtctttggatgtatataggaaaattccagagcacgtcctt
ggaagaattgcagttgcagttgttaaaggccttacctatctgtggagtttaaagatttta
cacagagatgtgaagccctccaacatgcttgtaaacacaggcggacaggtcaagctgtgt
gactttggcgtgagcacacagctggtgaattctatagccaagacgtatgttggaacaaat
gcttacatggcaccagaaagaatttcaggagagcagtatgggatccattctgacgtgtgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
ccggtccttccgcttggagagttctcggagccgtttgtacatttcatcactcagtgcatg
aggaagcagcccaaggagagaccggcgcctgaggagctgatgggtcacccattcatcgtg
cagttcaatgatggaaactccactgtggtgtccatgtgggtgtgccgagctctagaggag
aggcggagccagcagggacccccgtga

DBGET integrated database retrieval system