KEGG   Mus musculus (mouse): 23939Help
Entry
23939             CDS       T01002                                 

Gene name
Mapk7, BMK-1, BMK1, ERK-5, ERK5, Erk5-T, PRKM7, b2b2346Clo
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04540  Gap junction
mmu04657  IL-17 signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05206  MicroRNAs in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23939 (Mapk7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    23939 (Mapk7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    23939 (Mapk7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    23939 (Mapk7)
   04921 Oxytocin signaling pathway
    23939 (Mapk7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    23939 (Mapk7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    23939 (Mapk7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    23939 (Mapk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    23939 (Mapk7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     23939 (Mapk7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   23939 (Mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Rrn6
Motif
Other DBs
NCBI-GeneID: 23939
NCBI-ProteinID: NP_001277963
MGI: 1346347
Ensembl: ENSMUSG00000001034
Vega: OTTMUSG00000005833
UniProt: Q9WVS8
Position
11; 11 B2
AA seq 806 aa AA seqDB search
MAEPLKEEDGEDGSGEPPGRVKAEPVHTAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LKPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSDPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPAPAPAPAPAPSSAQPTS
TPTGPVSQSTGPLQPAGSIPGPASQPVCPPPGPVPQPAGPIPAPLQTAPSTSLLASQSLV
PPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVEDPLPPVF
SGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPA
DIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgctgaaggaggaggacggcgaagatggctctggggagccccctgggagg
gtgaaggcagaacccgttcacaccgctgcctctgtggtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcttcggcgcgccgccgcctcacgggccagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggagctgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaagcctactgtgccctatggagaattcagatctgtctatgtggtactggacctcatg
gagagcgacctacaccagatcattcactcttcacagccgctcaccctggaacatgtgaga
tacttcctgtaccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgtgatcttaaaccctctaaccttctggtcaatgagaactgtgagctcaagatcggtgac
tttggaatggcccgtggcctctgtacttcccctgccgagcaccagtacttcatgactgag
tatgtggctactcgctggtaccgtgccccggagctcatgctttccctgcacgagtatacg
caggcaatcgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgccag
ctcttcccaggcaaaaactacgtgcaccagttacagctgatcatgatggtgttgggaact
ccgtcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcaacctgtgccttgggagacagtatacccaggtgctgaccgccaggcc
ctctccctgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccatgaccctgatgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaatccgc
ttccagccttctctgcagcctgtggctagtgagcctgtgtgtccagatgttgagatgccc
agtccctgggctccaagtggagactgtgccatggagtcgcctcctccagcactgccacca
tgctctgatcctgcacctgacaccgttgatctgactctgcagcctgccccgccggccagt
gagcttgctccaccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgccctgctcaagtccctaaggagcaggctcagagatgggcccagtgcacccttggag
gcgcctgagcctcgaaagcccgtgacagctcaggaacgccagcgagaacgagaagagaag
cgcaggaggcgacaagagagagccaaggagcgggagaagcgacgacaagagagagaacgc
aaggagaggggggctggtaccttggggggcccctctactgaccctctggctggactggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgcc
cctgcccctgccccagcgccagcaccagcgccagcaccgtcctctgcccagcccactagt
actcctactggccccgtatctcagtctactggtcctctacagcctgcaggctctattccg
ggtcctgcctcccagcctgtttgcccaccccctggccctgttccccagcctgctggccct
atccctgctccgctccagactgccccttccactagccttttggcctcccagtcacttgtg
ccacctagtgggttgcctggttctggtgccccagaagttctgccttacttcccatctggc
ccaccacctccagatcctgggctcacccctcagccttctacatcagagtcacctgatgtc
aacctggtgactcagcagctgtccaagtctcaggtggaggaccccctgcctcctgtgttc
tctggcactccaaagggcagtggggctggctacggagttggctttgatctggaggaattc
ttaaatcaatcttttgatatgggtgtggctgatgggccacaggatggccaggcagactca
gcctcactctcagcctctctccttgctgactggcttgagggccatggcatgaaccctgct
gacattgagtctctgcagcgtgagatccagatggactccccaatgctgctgtctgacctg
cctgacctccaagagccctga

DBGET integrated database retrieval system