KEGG   Mus musculus (mouse): 239408Help
Entry
239408            CDS       T01002                                 

Gene name
Tmem74, AA549547, B230382K22Rik
Definition
(RefSeq) transmembrane protein 74
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Neurensin
Motif
Other DBs
NCBI-GeneID: 239408
NCBI-ProteinID: NP_780711
MGI: 2443417
Ensembl: ENSMUSG00000054409
UniProt: Q8BQU7
Position
15; 15 B3.2
AA seq 305 aa AA seqDB search
MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL
STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL
EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS
AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT
LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA
LAVQS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagctccactctctgtctaagaggaacagcccagtggacccatgcaatgctttggag
tggagttcaggagagacttctggtgaccatatagaagaggcaaccatcagagatgctttt
tgctatcagaaaaacttggtatcaacaccaagggcagatgtggtggaagtgtgtagactt
agcacttctccagcatccccaacctccttgctccaagacagtgctattcaaacaagcttc
tccctatctggacctcctgactcagggaacaaccaagtaatggctgatcgcaaagtctgt
aattgttgcagccaggaactagaaacttcttttacttacgtggatgagaacgtcaacttg
gaacagagaagtcagaggtcaccatcagccaaaggcagtaatcaccctgtagatctggga
tggggaaaccctaatgaatggtctcatgaaactgccatgtctttgatgtcggaagacgat
gatgatacaagttcagaagccacatcttcagggaagtctgtagactatggtttcatcagc
gctatcttgttcttggtcactggtatcttgctagtgatcatttcttatatcgtccctcgg
gaggtgacagtggatcccaatacagtggcagcccgggaaatggaacgcctagaaaaggag
agtgcaatgctaggtgcacacctggaccgttgtgtgatcgctgggctctgcctcctcact
ctcgggggagttgttctgtcttgtttgctgatgatgtctatgtggaagggagagctctat
cgtcgaaatagatttgcctcttccaaagagtctgcaaaactctatggttctttcaacttc
aggatgaaaactagtactaatgaagacactctggaactgtccttggtagaggaagatgcc
cttgctgtacagagttag

DBGET integrated database retrieval system