KEGG   Mus musculus (house mouse): 239408
Entry
239408            CDS       T01002                                 
Symbol
Tmem74, AA549547, B230382K22Rik
Name
(RefSeq) transmembrane protein 74
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Neurensin
Other DBs
NCBI-GeneID: 239408
NCBI-ProteinID: NP_780711
MGI: 2443417
Ensembl: ENSMUSG00000054409
UniProt: Q8BQU7
Position
15:complement(43726741..43733462)
AA seq 305 aa
MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL
STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL
EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS
AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT
LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA
LAVQS
NT seq 918 nt   +upstreamnt  +downstreamnt
atggagctccactctctgtctaagaggaacagcccagtggacccatgcaatgctttggag
tggagttcaggagagacttctggtgaccatatagaagaggcaaccatcagagatgctttt
tgctatcagaaaaacttggtatcaacaccaagggcagatgtggtggaagtgtgtagactt
agcacttctccagcatccccaacctccttgctccaagacagtgctattcaaacaagcttc
tccctatctggacctcctgactcagggaacaaccaagtaatggctgatcgcaaagtctgt
aattgttgcagccaggaactagaaacttcttttacttacgtggatgagaacgtcaacttg
gaacagagaagtcagaggtcaccatcagccaaaggcagtaatcaccctgtagatctggga
tggggaaaccctaatgaatggtctcatgaaactgccatgtctttgatgtcggaagacgat
gatgatacaagttcagaagccacatcttcagggaagtctgtagactatggtttcatcagc
gctatcttgttcttggtcactggtatcttgctagtgatcatttcttatatcgtccctcgg
gaggtgacagtggatcccaatacagtggcagcccgggaaatggaacgcctagaaaaggag
agtgcaatgctaggtgcacacctggaccgttgtgtgatcgctgggctctgcctcctcact
ctcgggggagttgttctgtcttgtttgctgatgatgtctatgtggaagggagagctctat
cgtcgaaatagatttgcctcttccaaagagtctgcaaaactctatggttctttcaacttc
aggatgaaaactagtactaatgaagacactctggaactgtccttggtagaggaagatgcc
cttgctgtacagagttag

DBGET integrated database retrieval system