KEGG   Mus musculus (mouse): 23943
Entry
23943             CDS       T01002                                 

Symbol
Esyt1, Fam62a, Mbc2, vp115
Name
(RefSeq) extended synaptotagmin-like protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: C2 SMP_LBD
Other DBs
NCBI-GeneID: 23943
NCBI-ProteinID: NP_035973
MGI: 1344426
Ensembl: ENSMUSG00000025366
UniProt: Q3U7R1
Position
10:complement(128346117..128361728)
AA seq 1092 aa
MEHSPEEGASPEPSGQPPATDSTRDGGSGVPPAGPGAASEALAVLTSFGRRLLVLVPVYL
AGAAGLSVGFVLFGLALYLGWRRVRDGKERSLRAARQLLDDEERITAETLYMSHRELPAW
VSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGANPHLQTFTFTRVELGEKP
LRIIGVKVHPSQRKDQILLDLNVSYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPL
TGDLPIVGAVSMFFIKRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLV
PLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRVGTQTFC
SRVIDEELNPHWGETYEVIVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKVLQAGVLD
NWYPLQGGQGQVHLRLEWLSLLPDAEKLDQVLQWNRGITSRPEPPSAAILVVYLDRAQDL
PLKKGNKEPNPMVQLSVQDVTRESKATYSTNSPVWEEAFRFFLQDPRSQELDVQVKDDSR
ALTLGALTLPLARLLTASELTLDQWFQLSSSGPNSRLYMKLVMRILYLDYSEIRFPTVPG
AQDWDRESLETGSSVDAPPRPYHTTPNSHFGTENVLRIHVLEAQDLIAKDRFLGGLVKGK
SDPYVKLKVAGKSFRTHVVREDLNPRWNEVFEVIVTSIPGQELEIEVFDKDLDKDDFLGR
YKVSLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSS
ELAAALLSVFLERAEDLPLRKGTKPPSPYATITVGETSHKTKTVSQSSAPVWEESASFLI
RKPHAESLELQVRGEGTGTLGSVSLPLSELLQEDQLCLDHWFALSGQGQVLMRAQLGILV
SQHSGVEAHSHSYSHSHSSSSLNDEPEALGGPTHPASPVLEVRHRLTHGDSPSEAPVGPL
GQVKLTVWYHSDEQKLISIIHSCRALRQNGRDLPDPYVSVLLLPDKNRSTKRKTPQKKRT
LNPEFNERFEWDLPLDGTLRRKLDVSVKSNSSFMSRERELLGKVQLDLAEIDLSQGAAQW
YDLMDDRDKGGS
NT seq 3279 nt   +upstreamnt  +downstreamnt
atggagcactcccctgaagagggcgccagccccgagccgtcagggcagccccctgccacg
gactccacgcgggacgggggctccggggtcccacctgccggcccaggtgcggcgagcgag
gccctggcggtgctgacttccttcgggcgccgcttgttggtgctggtgccggtgtacctg
gcaggggcagcgggtcttagcgtaggtttcgtgcttttcggcctcgccctgtacttgggc
tggcgccgggtccgcgatgggaaagaacggagcctgagggcagcgaggcagctgctggat
gacgaggagcggatcaccgcagagacgctttatatgagccaccgggaactacctgcctgg
gtcagcttcccagatgtggaaaaggccgaatggctgaacaagatcgtggctcaggtgtgg
cccttcctaggccagtatatggagaagcttctggcggagacagtggccccagctgtccgg
ggagctaaccctcatctgcagacattcacattcacacgtgtggagctgggtgaaaagcca
ttacgaatcattggcgtcaaagttcaccctagtcagaggaaagatcagattctgttggac
ttgaatgtcagctatgtaggtgatgtacagattgacgtggaggtgaagaaatatttctgc
aaagctggagtcaagggcatgcagctccatggtgtcttgcgagtgattcttgagccactc
acaggggaccttcctatcgtgggggctgtgtccatgttctttatcaaacgcccgacgctt
gacatcaactggacagggatgaccaacctgctagatatcccaggacttagctcactctct
gacaccatgatcatggactccattgctgccttcctcgtgctccctaaccgactgttggtg
ccccttgtgcccgaccttcaagatgtggcccagctgcggtccccactacccaggggcatt
atccggattcacctgctggcagcccgaggtctgagttccaaggacaagtatgtgaaaggc
ctgattgagggcaaatcggatccctacgcgctcgtccgtgtgggcacccagacgttctgc
agccgtgtcatagatgaggagctcaaccctcactggggagagacatatgaggtgatagtc
cacgaggttccaggacaggagatcgaggtggaggtatttgacaaagatccagataaagat
gattttctgggaagaatgaagctggacgtggggaaggtattacaggctggagtcctggat
aattggtaccctctgcaaggcgggcaaggccaagttcacttgagactagaatggctatca
ctcctgccagatgcagagaagctggatcaggtcctgcagtggaatcggggcatcacttct
cggccagagcccccatcggctgccatcctcgttgtctacttggaccgagcccaggacctt
cctctgaagaaaggcaacaaggaacccaaccccatggtgcaactatcagttcaggatgtg
acccgggagagcaaggctacctacagcaccaacagcccggtgtgggaagaggctttccgg
tttttcctgcaggaccctcgaagccaggagcttgatgtacaggtgaaggacgactcccga
gccctgactttaggggccctgactctccctcttgcgcgcctgttgactgcctctgaactc
accctggaccagtggttccagctcagcagctcaggcccaaactccaggctctacatgaaa
ctggtcatgcggatcttatacttagattactcggaaatccgcttccccactgtgcctggt
gcccaggactgggaccgtgagagcctagagacaggcagcagtgtggatgccccacctcgg
ccctatcacacaacccctaacagccactttgggactgagaatgttcttcggatccatgta
ttagaagcgcaggacctaattgccaaagaccgtttcttgggaggcctggtgaagggcaaa
tcagacccctacgtcaaactaaaggtggcaggaaaaagtttccggacccatgttgttcgg
gaagatctcaatccccgctggaatgaggtttttgaggtgattgtcacatcaatccctggc
caagagcttgagattgaggtctttgataaggacttggacaaggatgactttttgggcagg
tataaagtgagtctcaccacagtgctcaacagtggctttcttgatgagtggctgaccctg
gaggatgtcccatccgggcgcctgcacttgcgcctggagcgtctgacccctagaccgact
gctgctgagttagaggaggtgctgcaggtgaacagcctgatccagactcagaagagttca
gagctggcagcagccctgctgtccgtcttcctggagcgggcagaagatctgccgctccga
aaaggtaccaagcctcccagcccttacgctactatcaccgtgggagagacttcccataaa
accaagactgtctcccaatcttcggcccctgtctgggaggagagtgcctcttttctcatc
aggaagccacacgctgagagcctggagctgcaggttcggggtgaagggaccggcaccctg
ggctctgtatcccttcctctctctgagctcctccaggaggaccagctctgcctggaccac
tggtttgcactcagtggtcagggccaggtgctgatgagagcgcagcttgggatcctggta
tctcagcactcgggagtggaagcccacagccacagctacagccacagtcacagctcctcc
tcgctcaatgacgaacctgaggccttagggggacccactcaccctgcctccccggtccta
gaggtcaggcatcgcctaacacatggtgacagtccctctgaggctcccgttgggcccctg
ggccaggtgaagctgacagtgtggtaccacagcgacgaacaaaagctgatcagcattatt
cacagctgccgggcccttcgacaaaatggacgtgatctcccagacccctatgtgtcagtg
ttgctgctcccagacaagaaccgaagcaccaagaggaagaccccgcagaagaagaggacc
ctcaatcctgagttcaatgagcggtttgagtgggatctgcccctggatgggactctcagg
cggaagctcgatgtctctgtgaagtcaaactcctccttcatgtcacgagagcgtgagctt
ctggggaaggtgcagctggatctagcagagatagacctttcccagggtgcagcccagtgg
tatgacctgatggatgacagagataagggcggttcctag

DBGET integrated database retrieval system