KEGG   Mus musculus (mouse): 23945Help
Entry
23945             CDS       T01002                                 

Gene name
Mgll, AA589436, Magl, Mgl
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04923  Regulation of lipolysis in adipocytes
Module
mmu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    23945 (Mgll)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    23945 (Mgll)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    23945 (Mgll)
  09159 Environmental adaptation
   04714 Thermogenesis
    23945 (Mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    23945 (Mgll)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     23945 (Mgll)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S33
   23945 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Lipase_3 Esterase LIDHydrolase Abhydrolase_5 Abhydrolase_3 PGAP1 Thioesterase Peptidase_S9 BAAT_C DUF1057 DUF2920 Chlorophyllase2 Abhydrolase_2 DUF1350
Motif
Other DBs
NCBI-GeneID: 23945
NCBI-ProteinID: NP_035974
MGI: 1346042
Ensembl: ENSMUSG00000033174
Vega: OTTMUSG00000023902
UniProt: O35678
Position
6; 6 D1
AA seq 303 aa AA seqDB search
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcaagttcacccaggcgaactccacagaatgttccctaccaggacctgcct
cacctggtcaatgcagacggacagtacctcttttgtagatactggaagcccagtggcaca
cccaaggccctcatctttgtgtcccatggagctggggaacactgtggccgttatgatgag
ctggctcatatgttgaaggggctggacatgctggtatttgcccatgaccatgttggccat
gggcagagtgagggagagaggatggtggtgtcggacttccaagtttttgtcagagatgtg
ctgcaacacgtggacaccatccagaaggactaccccgacgtccccatcttcctcctgggc
cactccatgggcggtgccatctccatcctagtggctgcagagaggccaacctacttttct
ggcatggtcctgatttcacctctggtccttgccaatccggaatctgcatcgactttgaag
gtccttgctgccaaactgctcaattttgtcctgccaaatatgaccttggggcgcattgac
tccagcgtgctgtctcggaacaagtcggaggttgacctgtacaactctgacccactcgtc
tgccgagcagggctgaaggtgtgctttggcatacagctgctgaatgccgtcgcaagagtg
gagcgagcaatgcccaggctgacactgccattcctgctgctgcagggttctgctgaccgg
ctttgcgacagcaaaggtgcctacctgctcatggaatcatcccggagtcaggacaaaaca
ctcaagatgtatgaaggtgcctatcacgtcctccacagggagcttccggaagtgaccaac
tccgtcctccatgaagtaaactcgtgggtgtctcacaggatagcagcagcaggagctggg
tgtccaccctga

DBGET integrated database retrieval system