KEGG   Mus musculus (mouse): 23954Help
Entry
23954             CDS       T01002                                 

Gene name
Nek3
Definition
(RefSeq) NIMA (never in mitosis gene a)-related expressed kinase 3
  KO
K20873  NIMA (never in mitosis gene a)-related kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23954 (Nek3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NEK family
   23954 (Nek3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     23954 (Nek3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 23954
NCBI-ProteinID: NP_001156419
MGI: 1344371
Ensembl: ENSMUSG00000031478
Vega: OTTMUSG00000030469
UniProt: Q9R0A5
Position
8 A2; 8 11.07 cM
AA seq 511 aa AA seqDB search
MDNYTVLRVIGQGSFGRALLVLQESSNQTFAMKEIRLLKSDTQTSRKEAVLLAKMKHPNI
VAFKESFEAEGYLYIVMEYCDGGDLMQRIKQQKGKLFPEDTILNWFIQICLGVNHIHKRR
VLHRDIKSKNVFLTHNGKVKLGDFGSARLLSSPMAFACTYVGTPYYVPPEIWENLPYNNK
SDIWSLGCILYELCALKHPFQANSWKNLILKICQGPIHPLPALYSCKLQGLVKQMLKRNP
SHRPSATTLLCRGSLAPLVPKCLPPQIIREYGEQILDEIKISTPKNMKKQDSNRVRRALG
EANSASMQEEERGRKCSHTELESTGTTPAGNALERAARGNPESGNPQEHGRHTSPASPHR
PWWERHGPSSNVEALEKASILTSSFTAEDDRGGSVIKYEENARRQWVREPPEALLSMLKD
ADLSQAFQTYTIYRPGAEGFLKGPLSEDTASDSVDGDLDSVMLDPERFEPRLDEEDTDFE
EDNENPDWVSELKKHVGYGDGPGGQLLGERA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacaactacacagtcctgagagtgattggccagggctccttcggcagggctcttttg
gttctgcaggaaagcagcaatcagacatttgccatgaaggaaatcagactgctcaagtct
gatacacagacttctaggaaagaggctgttctgctcgccaaaatgaagcaccccaatatt
gttgcctttaaggagtcatttgaagctgaagggtacctgtacattgtgatggagtattgt
gacggaggggatctgatgcagaggattaaacagcaaaaagggaagttattccctgaagac
acgatacttaattggtttatacaaatttgtcttggagtaaatcacattcataagagacgt
gttttacacagagatatcaagtcgaaaaatgtcttcctcacccacaatggaaaagtgaaa
ttgggagattttggctctgcccgtcttctctccagtcccatggcgtttgcatgcacgtac
gtgggaacaccttattatgtgcctccagaaatctgggagaacctgccttacaacaataaa
agtgacatctggtccttgggatgcattctgtatgaactctgcgctctgaagcatccattc
caggcaaatagttggaaaaacctgatcctgaaaatatgccaggggcccatccacccgctg
ccggctctgtactcctgcaagcttcagggcctggtcaagcagatgctgaaaaggaaccct
tcccaccgcccctccgccacaaccctgctctgcaggggtagcttggctccactggtcccg
aagtgcttgccccctcagatcatcagagaatatggagaacagatattagatgaaatcaaa
atatccacgcctaagaatatgaaaaaacaggactccaacagagtcaggagagctctggga
gaagcaaactctgcctctatgcaagaggaagaacgtggtagaaagtgtagccatactgaa
ttggaaagcactggtacaaccccagctgggaatgcattggaaagagcagccagaggaaat
ccagaatcaggtaacccacaggagcacgggaggcataccagtccggcaagtcctcacagg
ccgtggtgggagagacacggtcccagttccaatgtcgaagctttggagaaagcatctatc
cttacctccagtttcacggcagaggatgacagaggtgggtctgtgataaagtatgaagaa
aatgcccgaaggcagtgggtcagagagccccctgaggccttgctgtcaatgctgaaggac
gctgatctcagtcaggcatttcagacatacacaatatatagaccaggtgcagaaggattc
ctgaaaggtcccctttctgaagacacggcatcggacagcgtcgacggtgatctcgattct
gtcatgttagacccagagagatttgaacctcggctggatgaagaagacacggactttgag
gaagataacgaaaaccctgattgggtgtcagaactaaagaagcacgtaggatacggggat
ggacctggtggacaactcctcggagaacgtgcctga

DBGET integrated database retrieval system