KEGG   Mus musculus (mouse): 239552Help
Entry
239552            CDS       T01002                                 

Gene name
Apol8, 9830006J20Rik, APOL-II, Apol2
Definition
(RefSeq) apolipoprotein L 8
  KO
K14480  apolipoprotein L
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    239552 (Apol8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL Fungal_trans_2 tRNA-synt_His SAM_4
Motif
Other DBs
NCBI-GeneID: 239552
NCBI-ProteinID: NP_001075439
MGI: 2444921
Ensembl: ENSMUSG00000056656
UniProt: A2VDH7
Position
15; 15 E1
AA seq 339 aa AA seqDB search
MDPSDCEDAPGDRTFIEEAAEYLQHTSGREDLRLLLTEDGAWEAFVAEAELSRADADTLR
DALHALTANLAVEDQERLQRDLQDMERFMDAFPQVKLELEGHIGKLRTLADKVDKVHRDC
TISKLVAGSTSTVSGILTLLGLTLVPVTAGISLVLLATGMGLGAAAAVTSVSSGIVDYTS
RSLAKTEASHLVSTGMAKVKMVADAVVHSGPQVLSLSENCCRVLRCIEQSIYAIKLTKAN
PALAASAMGSTSAQSGKHVKKAFKGTALAISRRARIMGIATAGVSLVGDVISLVKQSKNL
HKGTKAKSAEELRQQARELEEKLEALIQMYEGLQAGSRR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggacccttcagactgcgaggatgccccaggagacagaaccttcattgaggaagccgct
gagtacctgcagcacacatcgggcagggaagacctgaggctgctgctgaccgaagatgga
gcctgggaggcctttgtggcggaagctgagttgtccagagctgatgcagacactttacgc
gacgccctccatgcactcacagcaaacctggctgtggaagaccaggaaaggctccaacgt
gacctgcaggacatggagaggtttatggatgcgtttccccaggtgaaactggagctggag
ggacacatcgggaagctccgcaccctggcagacaaggttgacaaggtgcacagggactgt
accatctccaagcttgtggccggctccaccagcactgtgtctggcatcctgaccctcctt
ggcctcactctggtacccgtgacagctgggatcagtctggtactcttggcaacagggatg
ggcctgggagcagcagcggctgtgactagtgtctcctctgggatcgtggactacacaagt
aggtcattagccaaaacggaagccagccacctggtgtcaaccggcatggccaaagtgaag
atggttgcagacgctgtggttcattcaggaccccaggtcttgtccttatctgagaattgc
tgccgtgtcctacggtgcattgagcagagcatctatgccatcaagctcaccaaagccaac
cctgccttagcagctagtgccatggggagcacctctgcccaaagtggtaagcacgtgaag
aaggcctttaaaggcactgccctggcaataagcagaagagcccggatcatgggtatagcc
accgcaggtgtgtccctcgttggggatgtgatcagccttgtgaaacagtccaagaatttg
cacaagggcacaaaagcaaagtctgccgaggagttgaggcagcaggctcgggagctggag
gagaaactggaggcgctcatccagatgtatgaaggtttgcaggcaggctcaaggcggtaa

DBGET integrated database retrieval system