KEGG   Mus musculus (mouse): 23960
Entry
23960             CDS       T01002                                 

Gene name
Oas1g, AI449562, L, L2, Mmu-, Mmu-L, Mmu-L2, O, Oas1b, Oi, Oias-1, Oias1
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1G
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    23960 (Oas1g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    23960 (Oas1g)
   05171 Coronavirus disease - COVID-19
    23960 (Oas1g)
   05164 Influenza A
    23960 (Oas1g)
   05162 Measles
    23960 (Oas1g)
   05168 Herpes simplex virus 1 infection
    23960 (Oas1g)
   05169 Epstein-Barr virus infection
    23960 (Oas1g)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     23960 (Oas1g)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 23960
NCBI-ProteinID: NP_035982
MGI: 97429
Ensembl: ENSMUSG00000066861
Vega: OTTMUSG00000030607
UniProt: Q8K469
Position
5 F; 5 60.65 cM
AA seq 367 aa
MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVV
KGGSSGKGTTLKGRSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKF
EVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHGSINKKPNPLIYTILIWECTS
LGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVY
AWEQGNGCNEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHKEVSKYLHRQLRKARPVI
LDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFMKNDGSRVSSWDVPTVVPVPFEQVEE
NWTCILL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagcacggactcaggagcatcccagcctggacgctggacaagttcatagaggattac
ctccttcccgacaccacctttggtgctgatgtcaaatcagccgtcaatgtcgtgtgtgat
ttcctgaaggagagatgcttccaaggtgctgcccacccagtgagggtctccaaggtggtg
aagggtggctcctcaggcaaaggcaccacactcaagggcaggtcagacgctgacctggtg
gtgttccttaacaatctcaccagctttgaggatcagttaaaccgacggggagagttcatc
aaggaaattaagaaacagctgtacgaggttcagcatgagagacgttttagagtcaagttt
gaggtccagagttcatggtggcccaacgcccggtctctgagcttcaagctgagcgccccc
catctgcatcaggaggtggagtttgatgtgcttccagcctttgatgtcctgggtcatggt
agtatcaataagaagcctaatcccttaatctacaccatcctcatctgggaatgtacctcc
ctggggaaggatggcgagttctctacctgcttcacggagctccagcggaacttcctgaag
cagcgcccaaccaagctgaagagtctcatccgcctggtcaaacactggtaccaactgtgt
aaggagaagctggggaagccactgcccccacagtatgccctggagctactcactgtctat
gcctgggaacaggggaatggatgtaatgagttcaacacagcccagggcttccggaccgtc
ttggaactggtcatcaattatcagcatcttcgaatctactggacaaagtattatgacttt
caacacaaggaggtctccaaatacctgcacagacagctcagaaaagccaggcctgtgatc
ctggacccagctgacccgacagggaatgtggctggtgggaacccagagggctggaggcgg
ttggctgaagaggctgatgtgtggctgtggtacccatgttttatgaaaaatgatggttcc
cgagtgagctcctgggatgtgccgacggtggttcctgtaccttttgagcaggtggaggag
aactggacatgtatcctgctgtga

KEGG   Mus musculus (mouse): 23961
Entry
23961             CDS       T01002                                 

Gene name
Oas1b, F, Flv, L, L1, Mmu-L, Mmu-L1, O, Oas1, Oi, Oias-2, Oias2, W, Wnv
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1B
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    23961 (Oas1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    23961 (Oas1b)
   05171 Coronavirus disease - COVID-19
    23961 (Oas1b)
   05164 Influenza A
    23961 (Oas1b)
   05162 Measles
    23961 (Oas1b)
   05168 Herpes simplex virus 1 infection
    23961 (Oas1b)
   05169 Epstein-Barr virus infection
    23961 (Oas1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     23961 (Oas1b)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 tRNA_NucTransf2 DUF592
Other DBs
NCBI-GeneID: 23961
NCBI-ProteinID: NP_001077394
MGI: 97430
Ensembl: ENSMUSG00000029605
Vega: OTTMUSG00000043313
UniProt: Q60856
Position
5 F; 5 60.64 cM
AA seq 376 aa
MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVK
GKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSL
RSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEG
KLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYG
SRVTKFNTAQGFRTVLELVTKYKQLRIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPAD
PTRNIAGLNPKDWRRLAGEAATWLQYPCFKYRDGSPVCSWEVPTEVGVPMKYLFCRIFWL
LFWSLFHFIFGKTSSG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagcaggatctgaggagcatcccggcctcgaagcttgataagttcatagagaaccat
ctcccggacaccagcttctgtgctgacctcagagaagtcatagatgccctgtgtgctctc
ctgaaggacagatccttccggggccccgtccgccgaatgagggcctctaaaggggtcaag
ggcaaaggcaccacactcaagggcaggtcagacgctgacctggtggtgttccttaacaat
ctcaccagctttgaggatcagttaaaccaacagggagtgttgattaaggaaattaagaaa
cagctgtgcgaggttcagcatgagagacgttgtggagtgaagtttgaggtccacagttta
aggagtcccaactcccgggctctgagcttcaagctgagcgcccccgacctgctgaaggag
gtgaagtttgatgtgctgccagcctatgatttactggatcatcttaacatcctcaagaag
cctaaccaacaattctacgccaatctcatcagtgggcgtaccccgccggggaaggagggc
aagttatcgatctgctttatggggcttcggaagtacttcctgaactgtcgcccaaccaag
ctgaagcgcctcatccgcctggtcacgcactggtaccaactgtgtaaggagaagctgggg
gacccgctgcccccacagtatgccctggagctgctcacagtctatgcctgggagtatggg
agtcgagtaactaaattcaacacagcccagggcttccgaaccgtcttggaactggtcacc
aagtacaaacagcttcgaatctactggacagtgtattatgactttcgacatcaagaggtc
tctgaatacctgcaccaacagctcaaaaaagacaggcctgtgatcttggaccccgctgac
ccaacaaggaacatagctggtttgaacccaaaggactggcggcgtctagcaggagaggct
gccacctggctgcaatacccatgctttaagtacagggacggttccccagtgtgctcctgg
gaggtgccgacggaggttggagtgccaatgaagtatctcttttgtcgtattttctggtta
ttgttttggtctttgtttcatttcatctttgggaagacttcatctggatag

KEGG   Mus musculus (mouse): 246727
Entry
246727            CDS       T01002                                 

Gene name
Oas3, Oa, Oasl10
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246727 (Oas3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246727 (Oas3)
   05171 Coronavirus disease - COVID-19
    246727 (Oas3)
   05164 Influenza A
    246727 (Oas3)
   05162 Measles
    246727 (Oas3)
   05168 Herpes simplex virus 1 infection
    246727 (Oas3)
   05169 Epstein-Barr virus infection
    246727 (Oas3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246727 (Oas3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS PPR_1 Viral_P18 Polbeta
Other DBs
NCBI-GeneID: 246727
NCBI-ProteinID: NP_660261
MGI: 2180850
Ensembl: ENSMUSG00000032661
Vega: OTTMUSG00000036440
UniProt: Q8VI93
Position
5 F; 5 60.64 cM
AA seq 1138 aa
MDLFHTPAGALDKLVAHNLHPAPEFTAAVRGALGSLNITLQQHRARGSQRPRVIRIAKGG
AYARGTALRGGTDVELVIFLDCFQSFGDQKTCHSETLGAMRMLLESWGGHPGPGLTFEFS
QSKASRILQFRLASADGEHWIDVSLVPAFDVLGQPRSGVKPTPNVYSSLLSSHCQAGEYS
ACFTEPRKNFVNTRPAKLKNLILLVKHWYHQVQTRAVRATLPPSYALELLTIFAWEQGCG
KDSFSLAQGLRTVLALIQHSKYLCIFWTENYGFEDPAVGEFLRRQLKRPRPVILDPADPT
WDVGNGTAWRWDVLAQEAESSFSQQCFKQASGVLVQPWEGPGLPRAGILDLGHPIYQGPN
QALEDNKGHLAVQSKERSQKPSNSAPGFPEAATKIPAMPNPSANKTRKIRKKAAHPKTVQ
EAALDSISSHVRITQSTASSHMPPDRSSISTAGSRMSPDLSQIPSKDLDCFIQDHLRPSP
QFQQQVKQAIDAILCCLREKSVYKVLRVSKGGSFGRGTDLRGSCDVELVIFYKTLGDFKG
QKPHQAEILRDMQAQLRHWCQNPVPGLSLQFIEQKPNALQLQLASTDLSNRVDLSVLPAF
DAVGPLKSGTKPQPQVYSSLLSSGCQAGEHAACFAELRRNFINTCPPKLKSLMLLVKHWY
RQVVTRYKGGEAAGDAPPPAYALELLTIFAWEQGCGEQKFSLAEGLRTILRLIQQHQSLC
IYWTVNYSVQDPAIRAHLLCQLRKARPLVLDPADPTWNVGQGDWKLLAQEAAALGSQVCL
QSGDGTLVPPWDVTPALLHQTLAEDLDKFISEFLQPNRHFLTQVKRAVDTICSFLKENCF
RNSTIKVLKVVKGGSSAKGTALQGRSDADLVVFLSCFRQFSEQGSHRAEIISEIQAHLEA
CQQMHSFDVKFEVSKRKNPRVLSFTLTSQTLLDQSVDFDVLPAFDALGQLRSGSRPDPRV
YTDLIHSCSNAGEFSTCFTELQRDFITSRPTKLKSLIRLVKYWYQQCNKTIKGKGSLPPQ
HGLELLTVYAWEQGGQNPQFNMAEGFRTVLELIVQYRQLCVYWTINYSAEDKTIGDFLKM
QLRKPRPVILDPADPTGNLGHNARWDLLAKEATVYASALCCVDRDGNPIKPWPVKAAV
NT seq 3417 nt   +upstreamnt  +downstreamnt
atggacctgttccacacgccagccggagctctggataagctggtggcccacaacctgcac
ccagcccctgagttcacagcagccgtacggggtgctctggggtcgctaaacatcacccta
cagcagcacagagcccgagggtcacagagaccaagagtgataaggattgccaagggagga
gcctatgcccggggcacagctctcagaggtggcaccgatgtcgaactcgtcatcttcctc
gactgcttccagagctttggtgaccagaagacctgtcactcagagaccctgggtgccatg
cgaatgttgctggagtcctgggggggccaccccgggcctggcctgacttttgagttttct
cagtcaaaggcgtccaggatcttacagtttcgtctggcatcggcagacggagaacactgg
atagatgttagcctggtgcctgcctttgatgtcctaggacagccccgctctggagtcaag
ccgacacccaacgtgtactcctccctccttagcagccactgccaggccggggagtactca
gcctgcttcactgagccccgaaagaactttgtgaacactcgcccagccaagcttaagaac
ttaatcctgctggtcaaacactggtaccaccaggtgcagacacgggccgtgagggccaca
ctgccccccagctacgccctagagctgcttaccatctttgcctgggagcagggctgtggg
aaggacagcttcagcctggcccaagggctccggaccgtcctggccttgatccaacacagc
aagtacctctgcattttctggacggaaaactatggcttcgaggaccctgcagttggagag
ttcttgcgaaggcagcttaagagacccaggcccgtgatcctggatccagctgatccaacg
tgggacgtgggcaacgggacagcctggcgctgggatgtgctggcccaggaggctgagtcc
agctttagccagcagtgcttcaagcaggcctcaggagtccttgtgcagccttgggagggg
ccgggcctgccacgggctgggatcttggatttgggccacccaatctatcaagggcctaac
caggcccttgaagacaacaaaggccaccttgctgttcagtcaaaggaaaggagccaaaaa
ccttccaattcagctccaggatttccagaagcagccaccaagatccctgctatgcccaac
ccaagtgccaataaaacccgcaagatccgcaagaaagcagctcacccaaagactgtccag
gaagcagcattggatagtatctcaagtcatgttcggatcacccagagcacagcatcctca
cacatgcctcctgaccgctctagcatctccaccgctgggtcacggatgagcccagatctg
tcacagatccccagcaaggatctagactgcttcatccaggaccaccttaggccgagtccc
cagttccagcagcaggtgaagcaggccatcgacgccatcttgtgctgcctccgggagaag
agtgtatacaaagtcttgagggtcagcaagggcggctctttcggccgtggcacagacctc
aggggcagctgcgatgtggaacttgtcatcttttataaaaccctcggggacttcaagggc
cagaagcctcaccaggcagagatcctgcgtgacatgcaggcccagctacgacactggtgt
cagaaccccgtgcctggactgagcctccagtttattgaacagaagcccaacgctctgcaa
ctccagctggcgtccaccgacctcagcaaccgggtggacctcagtgtgctgcctgctttt
gatgctgtggggccgctgaagtccggcaccaaacctcagccccaggtgtactcctcgctc
ctcagcagcggctgccaggctggggagcacgcagcctgcttcgcagagcttcgaaggaac
ttcataaacacttgccctcccaaacttaagagcctgatgctactggtcaaacactggtac
cgccaggttgtcactcgatataaaggaggagaggcggcaggtgatgctccgcccccagcc
tacgccctggagctcctgaccatctttgcctgggaacaaggctgtggagagcaaaagttc
agcctggctgaaggcctgcggaccatcctgaggctgatccaacagcaccagtcgctttgt
atctactggacggtcaactacagtgtgcaggacccggccatcagagcacatcttctctgc
cagcttcggaaagccaggcctctagtcctggaccctgcagatcccacctggaacgtgggc
cagggcgactggaagctattagctcaggaggcagctgcccttgggtcacaagtctgcctt
cagagtggggatgggactctggtgccaccctgggatgtgacgccagccctccttcaccag
accctagctgaggacctggacaaattcatcagtgaattcctccagcccaaccgccacttc
ctgactcaagtgaagagagccgtggacaccatatgttccttcctgaaagaaaactgcttc
cggaactctaccatcaaggtgctcaaggtggtcaagggtgggtcttctgccaaaggcacg
gctctacaaggacgctcagatgccgacctggtggtgtttctcagctgcttccgccagttc
tctgagcaaggcagccatcgggcagagatcatctcggagatccaggctcatctggaggcg
tgtcagcagatgcacagcttcgatgtcaagtttgaggtctccaagaggaagaacccccga
gtgctcagcttcacgctgacatcccagacgctgctggaccaaagcgtggactttgacgtc
ctgccagcctttgatgctctcggccagctgaggtccggctctcggcctgatccccgggtc
tacacagacctcatccacagctgcagtaatgcaggagagttctctacctgcttcacagag
ctgcagagggacttcattacctcccgtcccaccaaactcaagagcctgatccggctggtg
aaatactggtaccaacagtgtaacaagaccatcaaggggaagggttccttgcctccccag
cacgggctggagctcctaactgtgtacgcctgggagcaaggtggccagaatccccagttc
aacatggcggagggcttccgcactgttctggagctgattgtccagtaccggcagctctgc
gtctattggaccatcaactacagcgcagaagacaagaccatcggtgacttcctgaagatg
cagcttcggaagcccaggcctgtcatcctggacccagctgacccgacaggcaacctgggc
cacaacgctcgctgggatctgcttgccaaggaggctaccgtgtacgcatctgccctgtgc
tgcgtggacagggatggcaatcccatcaagccatggccggtaaaggccgctgtgtga

KEGG   Mus musculus (mouse): 246728
Entry
246728            CDS       T01002                                 

Gene name
Oas2, Oa, Oasl11
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246728 (Oas2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246728 (Oas2)
   05171 Coronavirus disease - COVID-19
    246728 (Oas2)
   05164 Influenza A
    246728 (Oas2)
   05162 Measles
    246728 (Oas2)
   05168 Herpes simplex virus 1 infection
    246728 (Oas2)
   05169 Epstein-Barr virus infection
    246728 (Oas2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246728 (Oas2)
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2 DZF POX DUF2630 Polbeta
Other DBs
NCBI-GeneID: 246728
NCBI-ProteinID: NP_660262
MGI: 2180852
Ensembl: ENSMUSG00000032690
Vega: OTTMUSG00000025348
UniProt: E9Q9A9
Position
5 F; 5 60.64 cM
AA seq 742 aa
MGNWLTGNWSSDRSSGYSSGWSPGGSSGVPSGPVHKLEKSIQANLTPNENCLKQIAVSSV
PSQKLEGYIQENLKPNRESLKQIDQAVDAIWDLLRSQIPVKEVAKGGSYGRETALRGCSD
GTLVLFMDCFQQFQDQIKYQDAYLDVIELWLKIHEKKSVKHEHALVVQVSVPGQRILLQL
LPVFNPLRSNENPSSCVYVDLKKSMDQVRASPGEFSDCFTTLQQRFFKKYPQRLKDLILL
VKHWYEQCQEKWKTPPPQPLLYALELLTVYAWEQGCQAEDFDMAQGVRTVLRLIQRPTEL
CVYWTVNYNFEDETVRNILLHQLRSQRPVILDPTDPTNNVGKDDGFWELLTEEAMAWLYS
PSLNTESPAPYWDVLPMPLFVTPSHLLNKFIKDFLQPNKLFLKQIKEAVDIICSFLKNVC
FLNSDTKVLKTVKGGSTAKGTALKRGSDADIVVFLSSLESYDSLKTNRSQFVQEIQKQLE
EFVQAQEWEVTFEISKWKAPRVLSFTLKSKTLNESVEFDVLPAYDALGQLRSDFTLRPEA
YKDLIELCASQDIKEGEFSICFTELQRNFIQTRPTKLKSLLRLIKHWYKQYERKMKPKAS
LPPKYALELLTVYAWEQGSGTDDFDIAEGFRTVLDLVIKYRQLCIFWTVNYNFEEEYMRK
FLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLLAEEAKEWLSSPCFQVEQKGLVQPWKV
PVMQTPGSCGGQIYPTVGGVTK
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgggaaactggctgactggaaactggtcatctgacaggtcatctggctattcatctggc
tggtcacctggtgggtcttcaggggtgccctccgggccagtgcacaagttagaaaagtct
atccaggcaaacctcacacccaacgaaaactgtctgaagcagattgcggtgtcctcggtg
ccatcgcagaagctagaagggtatatccaggaaaacctcaaacctaacagagaatctctg
aagcagatagaccaggccgtggatgccatctgggacctgctgcgcagtcagatccctgtg
aaggaagtggctaagggtggctcctatggccgggaaacagccctaagaggctgctccgat
ggtacccttgttctcttcatggactgcttccaacagttccaggatcagataaaataccaa
gatgcataccttgacgtcattgaactgtggctgaaaatccatgagaagaagtcagtaaag
catgaacatgcccttgtagtacaagtgtctgtaccagggcagagaatactcctgcaatta
cttccagtcttcaatcctctacgctccaatgagaatcccagctcctgtgtctatgtggat
ctcaaaaaatccatggatcaagtaagagcctcaccaggggagttctcagactgcttcacc
acactgcagcagcggtttttcaagaaatatccccaaagactgaaggatttgatcctattg
gtcaagcactggtatgaacagtgccaggagaagtggaaaacacccccacctcagccattg
ctgtacgcactggaactgctcactgtgtatgcctgggaacagggctgccaagctgaagac
ttcgacatggcacaaggcgtcaggaccgtgctgcgacttatccagcggccgacagagctg
tgtgtctactggacagtcaattacaactttgaggatgagacagtccggaacatccttctg
caccagctcaggtcccaaagaccagtcatcttggatccaactgacccaaccaataatgtg
ggcaaagatgatgggttctgggagctactgacagaggaagctatggcctggctgtactct
cccagcctgaatactgagtcacctgcaccatattgggatgttctgcccatgccacttttc
gtcactccaagccacttactgaacaagttcatcaaggactttctccagcccaacaagctc
ttcctaaagcagatcaaggaagctgttgacattatatgttccttccttaaaaatgtctgc
ttcttgaattctgacaccaaagtcctgaagaccgtcaagggaggatccactgccaaaggc
acagctctgaagcggggatcagatgctgacattgttgtgttcctctcctcgctggagagt
tacgactctctaaaaaccaaccgctcccagttcgtccaggagatccagaagcagttagaa
gaattcgtgcaggcgcaggagtgggaggtgacgtttgagatttcaaaatggaaggctccc
agagtgctgagttttaccttgaaatccaagactctcaatgaaagtgtcgagttcgatgtc
cttcccgcctatgatgcactaggtcaactgcggtctgacttcaccctcaggcccgaagcc
tacaaggatctcattgagctgtgtgcatcacaggacatcaaagaaggagagttttctatc
tgttttactgagctgcagagaaacttcattcaaacccggcccaccaaactgaagagtcta
ctccgcctgatcaagcactggtacaaacagtatgaaaggaagatgaagccaaaagcatct
ttacccccaaagtacgccctggagctgctcaccgtgtatgcctgggagcagggcagtggc
acagatgactttgacattgctgaaggcttccggaccgtcctggacctggttataaaatac
cggcagctctgcatcttctggacagtcaattacaactttgaagaggaatacatgcggaag
ttcctactgacccagatccagaaaaagaggcctgtaatcctggatccagcagatcccaca
ggcgatgtgggaggaggtgaccgctggtgctggcatcttctagctgaagaagcgaaggag
tggctgtcctccccttgtttccaagtggagcaaaaaggcctggtacagccttggaaagtg
ccagtaatgcagacccccggaagctgtggaggtcagatctaccccactgtgggtggagtt
actaagtag

KEGG   Mus musculus (mouse): 246730
Entry
246730            CDS       T01002                                 

Gene name
Oas1a, L, L3
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1A
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246730 (Oas1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246730 (Oas1a)
   05171 Coronavirus disease - COVID-19
    246730 (Oas1a)
   05164 Influenza A
    246730 (Oas1a)
   05162 Measles
    246730 (Oas1a)
   05168 Herpes simplex virus 1 infection
    246730 (Oas1a)
   05169 Epstein-Barr virus infection
    246730 (Oas1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246730 (Oas1a)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS DZF
Other DBs
NCBI-GeneID: 246730
NCBI-ProteinID: NP_660212
MGI: 2180860
Ensembl: ENSMUSG00000052776
Vega: OTTMUSG00000026831
UniProt: P11928
Position
5 F; 5 60.65 cM
AA seq 367 aa
MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVV
KGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKF
EVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHVNTSSKPDPRIYAILIEECTS
LGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVF
AWEQGNGCYEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHQEVSKYLHRQLRKARPVI
LDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFIKKDGSRVSSWDVPTVVPVPFEQVEE
NWTCILL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagcacggactcaggagcatcccagcctggacgctggacaagttcatagaggattac
ctccttcccgacaccacctttggtgctgatgtcaaatcagccgtcaatgtcgtgtgtgat
ttcctgaaggagagatgcttccaaggtgctgcccacccagtgagggtctccaaggtggtg
aagggtggctcctcaggcaaaggcaccacactcaagggcaagtcagacgctgacctggtg
gtgttccttaacaatctcaccagctttgaggatcagttaaaccgacggggagagttcatc
aaggaaattaagaaacagctgtacgaggttcagcatgagagacgttttagagtcaagttt
gaggtccagagttcatggtggcccaacgcccggtctctgagcttcaagctgagcgccccc
catctgcatcaggaggtggagtttgatgtgctgccagcctttgatgtcctgggtcatgtt
aatacttccagcaagcctgatcccagaatctatgccatcctcatcgaggaatgtacctcc
ctggggaaggatggcgagttctctacctgcttcacggagctccagcggaacttcctgaag
cagcgcccaaccaagctgaagagtctcatccgcctggtcaagcactggtaccaactgtgt
aaggagaagctggggaagccattgcctccacagtacgccctagagttgctcactgtcttt
gcctgggaacaagggaatggatgttatgagttcaacacagcccagggcttccggaccgtc
ttggaactggtcatcaattatcagcatcttcgaatctactggacaaagtattatgacttt
caacaccaggaggtctccaaatacctgcacagacagctcagaaaagccaggcctgtgatc
ctggacccagctgacccaacagggaatgtggccggtgggaacccagagggctggaggcgg
ttggctgaagaggctgatgtgtggctatggtacccatgttttattaaaaaggatggttcc
cgagtgagctcctgggatgtgccgacggtggttcctgtaccttttgagcaggtagaagag
aactggacatgtatcctgctgtga

DBGET integrated database retrieval system