KEGG   Mus musculus (mouse): 23961
Entry
23961             CDS       T01002                                 

Gene name
Oas1b, F, Flv, L, L1, Mmu-L, Mmu-L1, O, Oas1, Oi, Oias-2, Oias2, W, Wnv
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1B
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    23961 (Oas1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    23961 (Oas1b)
   05171 Coronavirus disease - COVID-19
    23961 (Oas1b)
   05164 Influenza A
    23961 (Oas1b)
   05162 Measles
    23961 (Oas1b)
   05168 Herpes simplex virus 1 infection
    23961 (Oas1b)
   05169 Epstein-Barr virus infection
    23961 (Oas1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     23961 (Oas1b)
Motif
Pfam: OAS1_C NTP_transf_2 tRNA_NucTransf2 DUF592
Other DBs
NCBI-GeneID: 23961
NCBI-ProteinID: NP_001077394
MGI: 97430
Ensembl: ENSMUSG00000029605
Vega: OTTMUSG00000043313
UniProt: Q60856
Position
5 F; 5 60.64 cM
AA seq 376 aa
MEQDLRSIPASKLDKFIENHLPDTSFCADLREVIDALCALLKDRSFRGPVRRMRASKGVK
GKGTTLKGRSDADLVVFLNNLTSFEDQLNQQGVLIKEIKKQLCEVQHERRCGVKFEVHSL
RSPNSRALSFKLSAPDLLKEVKFDVLPAYDLLDHLNILKKPNQQFYANLISGRTPPGKEG
KLSICFMGLRKYFLNCRPTKLKRLIRLVTHWYQLCKEKLGDPLPPQYALELLTVYAWEYG
SRVTKFNTAQGFRTVLELVTKYKQLRIYWTVYYDFRHQEVSEYLHQQLKKDRPVILDPAD
PTRNIAGLNPKDWRRLAGEAATWLQYPCFKYRDGSPVCSWEVPTEVGVPMKYLFCRIFWL
LFWSLFHFIFGKTSSG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagcaggatctgaggagcatcccggcctcgaagcttgataagttcatagagaaccat
ctcccggacaccagcttctgtgctgacctcagagaagtcatagatgccctgtgtgctctc
ctgaaggacagatccttccggggccccgtccgccgaatgagggcctctaaaggggtcaag
ggcaaaggcaccacactcaagggcaggtcagacgctgacctggtggtgttccttaacaat
ctcaccagctttgaggatcagttaaaccaacagggagtgttgattaaggaaattaagaaa
cagctgtgcgaggttcagcatgagagacgttgtggagtgaagtttgaggtccacagttta
aggagtcccaactcccgggctctgagcttcaagctgagcgcccccgacctgctgaaggag
gtgaagtttgatgtgctgccagcctatgatttactggatcatcttaacatcctcaagaag
cctaaccaacaattctacgccaatctcatcagtgggcgtaccccgccggggaaggagggc
aagttatcgatctgctttatggggcttcggaagtacttcctgaactgtcgcccaaccaag
ctgaagcgcctcatccgcctggtcacgcactggtaccaactgtgtaaggagaagctgggg
gacccgctgcccccacagtatgccctggagctgctcacagtctatgcctgggagtatggg
agtcgagtaactaaattcaacacagcccagggcttccgaaccgtcttggaactggtcacc
aagtacaaacagcttcgaatctactggacagtgtattatgactttcgacatcaagaggtc
tctgaatacctgcaccaacagctcaaaaaagacaggcctgtgatcttggaccccgctgac
ccaacaaggaacatagctggtttgaacccaaaggactggcggcgtctagcaggagaggct
gccacctggctgcaatacccatgctttaagtacagggacggttccccagtgtgctcctgg
gaggtgccgacggaggttggagtgccaatgaagtatctcttttgtcgtattttctggtta
ttgttttggtctttgtttcatttcatctttgggaagacttcatctggatag

DBGET integrated database retrieval system