KEGG   Mus musculus (mouse): 23968
Entry
23968             CDS       T01002                                 

Symbol
Nlrp5, Mat, Mater, N, Nalp5, O, Op1, PAN11
Name
(RefSeq) NLR family, pyrin domain containing 5
  KO
K22626  NACHT, LRR and PYD domains-containing protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    23968 (Nlrp5)
   04054 Pattern recognition receptors [BR:mmu04054]
    23968 (Nlrp5)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      23968 (Nlrp5)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   23968 (Nlrp5)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_25 AAA NB-ARC AAA_22
Other DBs
NCBI-GeneID: 23968
NCBI-ProteinID: NP_035990
MGI: 1345193
Ensembl: ENSMUSG00000015721
Vega: OTTMUSG00000024411
UniProt: Q9R1M5
Position
7 A3; 7 10.22 cM
AA seq 1111 aa
MGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKDS
KAILKARGLEEEQKSESTMSPSENVSRAILKDSGSEEVEQASERKMTSPENDSKSIQKDQ
GPEQEQTSETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDTSVDLHYDSPEMKLLSDA
FKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVREIKWTEKS
SLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDWKDEQPIYI
LMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLVLENISNES
DRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGLYATLVFHQ
LTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEILALFHMNI
LLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEVKRTDDTRL
LGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYC
LFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTL
ELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKILCLELRNQS
CRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVE
TLRLDSCELTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLI
LDNCGLTPASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNH
CNIVDDAYGFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQL
TQNCCEDLACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSN
CCEALSLAISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRR
QLEEVEFVKPHVVIDGDWYASDEDDRNWWKN
NT seq 3336 nt   +upstreamnt  +downstreamnt
atgggtcctccagaaaaagaaagtaaagcaatcttgaaagcacgtggattggaagaggaa
cagaagtcagaaagaaaaatgacttctccagaaaacgacagtaaatcaatccagaaagac
caaggaccagagcaggagcagacatcagaaagcacaatgggtcctccagaaaaagacagt
aaagcaatcttgaaagcacgtggattggaagaggaacagaagtcagaaagcacaatgtct
ccttcagaaaatgtcagtagagcaatcctgaaagacagtggatcagaagaagtggaacag
gcgtcagaaagaaaaatgacttctccagaaaacgacagtaaatcaatccagaaagaccaa
ggaccagagcaggagcagacatcagaaaccttacaatctaaggaagaagatgaagtgaca
gaggcagataaagataatggaggtgacttacaagactacaaggcccatgtgattgctaag
ttcgacacaagtgtggatctacactatgacagcccagagatgaaattattgtctgatgct
tttaaaccataccagaaaaccttccagcctcacaccattatcctacatggaagaccagga
gttgggaagtcagctttggccagaagtattgttcttggctgggcacagggtaaactcttc
caaaaaatgtcctttgtcatcttcttctctgttagagaaataaagtggacagagaagagc
agtttggcacagctgattgctaaggagtgtccagactcctgggatctagtgacaaagatc
atgtcccaaccagaaagactcttgtttgtcatagatggcttggatgatatggactctgtc
ctccaacatgatgatatgacactatccagagactggaaggatgaacagcccatatacatc
ctgatgtacagcctcctgaggaaggctctcctacctcagtcctttctcatcattaccacc
agaaacacaggcttagaaaaactcaagtcaatggttgtgtcccccctctatatactggtt
gaaggactgtctgcatcaaggagatctcagctggtcctcgagaacatctccaatgagtct
gatagaatacaagtcttccattctctgatagaaaatcaccagctgtttgaccaatgccag
gccccctctgtgtgctccctggtctgtgaggctctacagctacagaagaaactgggaaag
agatgcaccctaccctgccagactctcaccggtttgtatgccacgttggtgtttcaccag
ctcaccttgaaaaggccttcccagagcgctctcagtcaggaagaacagattactctagtg
ggtttgtgcatgatggcagctgaaggagtgtggaccatgaggtcggtgttctatgatgat
gacctgaagaactatagcctaaaggagtctgagatcttggccctctttcacatgaacatc
cttctccaggttggccacaacagtgagcagtgttatgttttctcccacctcagcctgcag
gatttctttgctgccttatattatgttttagaagggctggaggaatggaatcagcatttt
tgcttcattgaaaaccaaaggagcatcatggaggtgaagagaactgacgacactcgcctc
ctcgggatgaagcgtttcttatttggcctcatgaacaaggatatcttgaagactctggag
gttctgtttgaatatcccgtgattccaactgttgagcagaagctccaacactgggtctct
ctgatagctcagcaggtcaatggcaccagcccaatggacaccctggatgccttctattgt
ctatttgagtctcaggatgaagagtttgttggcggggctctcaaacgcttccaagaagtg
tggctgctgattaaccagaagatggacttgaaggtctcttcctactgtctcaagcactgt
cagaacttgaaggcaatccgggtggatatcagagacctcctctcggtagataatactctc
gagctgtgccctgttgttactgtccaggagacacaatgtaagcccctcctcatggagtgg
tggggaaacttctgctctgtgcttggcagcctccggaacttgaaggagctggacttgggc
gacagcatcctgagtcaacgggccatgaagatactgtgcctcgagctgcggaatcagtcc
tgcagaatacagaagctgacgtttaagagtgcagaggtagtgtctggcctgaaacatctc
tggaagctcctttttagcaatcaaaacttaaagtacctcaatctagggaacactcccatg
aaggatgatgacatgaagttagcctgcgaagcgctgaaacatccaaagtgctccgtggag
actctgaggttggattcctgtgagttaaccatcattggttatgagatgatctccacgctt
cttatttcaaccaccaggctaaagtgtctcagcctggccaaaaatagagtgggagtaaaa
agcatgatatcccttgggaatgccttgagtagctcaatgtgtctactgcaaaagttgata
ctggacaactgtggcctcacacctgccagctgccaccttctggtctcagcccttttcagc
aaccagaacttgacacacctgtgcctgtcaaacaacagcctggggactgaaggagtgcaa
cagctgtgtcagttcctgaggaatccagaatgtgctctccagcggctgatactgaatcac
tgcaacattgtagatgatgcttatggcttcctggcaatgagacttgcaaacaacacaaag
ctgacccacctgagcctgaccatgaaccccgtaggggatggtgcaatgaagctactgtgt
gaagctttaaaggaacctacttgttaccttcaagaactggaactagtggactgccaactc
acacagaactgctgcgaggacctggcctgtatgatcacaacaaccaagcacttaaaaagt
ttggatcttggtaacaacgccctgggtgacaaaggagtcataaccctgtgtgagggactg
aagcaaagtagcagctccctgaggagacttgggttgggggcatgtaagttgacttccaat
tgctgtgaggcattgtcattggccatctcttgcaaccctcacctgaacagcctaaacctg
gtgaagaatgacttcagtacatcggggatgttgaagctgtgctctgcgttccaatgccct
gtctctaacctggggataattggcctgtggaagcaggagtactatgcccgagtgagaaga
cagctggaggaagttgagtttgtcaagccccacgtggtgattgatggtgattggtatgct
agtgatgaagatgaccgaaactggtggaaaaactga

DBGET integrated database retrieval system