KEGG   Mus musculus (mouse): 239691Help
Entry
239691            CDS       T01002                                 

Definition
(RefSeq) expressed sequence AU021092
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4735
Motif
Other DBs
NCBI-GeneID: 239691
NCBI-ProteinID: NP_001028392
MGI: 2146559
Ensembl: ENSMUSG00000051669
Vega: OTTMUSG00000028134
UniProt: Q3UST5
Position
16; 16 A1
AA seq 385 aa AA seqDB search
MARLGLLLLLLLALPPHFSSVSWPDTAQGTMANLILTALEKATLFLEDRLPTINLDGVVG
FQVLEVQLRGVQEKWAHKPLLQPLSMRAGQMANTLSALLQKSIFYLKQSDPTYLREFQPS
IQPGFWKLPNDWTRTNASLVYPWLEPLDSFSEESSDVCLVQLLGTGTDSSQPCRLSNFCR
TLMTKAGCSGYSLSHQLLFFLWARMQGCTEGLFLQSQHYMDIFCANMMELNHRAEAVGYA
YPTQDLFMENIMFCGMAGFSDFYKLRWLEAILSWQNPQVGCFGRPDTKGEPSEVPHQQGI
LRRVRRREKLFADGCSCHNTATAVAALGGFLYILAEYHPDNGDAHPEYYPNHGDPYSSSQ
SPASNYQDGAAGPDVQRTGRPLSVS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcgagactcgggctgcttctcctcctgctgctggccctgccaccacacttctcctca
gtgtcatggccagacactgcacagggcaccatggcaaacttgatcctgactgcattagaa
aaagccaccttgttcttggaggacaggctgcccacaatcaacctggatggtgtggtgggc
ttccaagtgctggaagtgcaactccgaggagttcaggaaaaatgggctcacaagcccttg
ctgcagcctctcagcatgcgcgctggacagatggccaacacactgtctgctctcctccaa
aaatccatcttctacctcaagcagagtgaccccacgtacctaagagagttccagccaagc
attcagcctgggttttggaagttgcccaatgactggacacgcaccaatgcctccctagtc
tacccctggctggaacccctggactctttctcagaggaaagcagcgatgtgtgcctggtg
caactactaggaacagggacagacagcagccagccttgcaggctctccaacttctgcaga
acccttatgaccaaggccggctgctcaggctacagcctctcccatcagctgctcttcttc
ctctgggccagaatgcaagggtgcacggagggactgttcctccagagccaacactacatg
gacatcttctgtgccaatatgatggaactgaaccacagagctgaggccgttggatacgct
taccccacccaagacctcttcatggaaaacattatgttctgtggtatggctggcttctct
gacttctacaagctgcgctggctggaggccattctcagctggcagaacccccaggtggga
tgcttcgggaggcctgacacaaagggtgaaccttctgaagttccacatcagcagggcatt
ctgagaagagtgcgaaggcgggaaaaactgttcgcagatggctgttcgtgccacaacaca
gccacagcagtcgcagccctgggtggctttctctacatcctggcagaataccacccagac
aatggagatgcacatccagaatactacccaaaccatggagatccatactcatcctcacag
tcaccagcaagcaactaccaagatggtgctgccggccctgacgtccagaggactggcagg
ccccttagtgtttcttaa

DBGET integrated database retrieval system