KEGG   Mus musculus (mouse): 23970
Entry
23970             CDS       T01002                                 

Gene name
Pacsin2, AI197433, SdpII
Definition
(RefSeq) protein kinase C and casein kinase substrate in neurons 2
  KO
K20123  protein kinase C and casein kinase substrate in neurons protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    23970 (Pacsin2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    23970 (Pacsin2)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_2 NPF ATG17_like Tweety SH3BP5
Other DBs
NCBI-GeneID: 23970
NCBI-ProteinID: NP_001152981
MGI: 1345153
Ensembl: ENSMUSG00000016664
UniProt: Q9WVE8 Q3TDA7 Q8BNK9
Structure
PDB: 
3LLL

Position
15; 15 E1
AA seq 486 aa
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWIAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHTACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQTTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVASYKTIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKAVDGVTLTGINQTGDQSGQNKPGSNLSVPSNPAQSTQLQSS
YNPFEDEDDTGSSISEKEDIKAKNVSSYEKTQTYPTDWSDDESNNPFSSTDANGDSNPFD
EDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPAN
YVEAIQ
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtctgtcacctacgatgactctgtgggagtggaagtgtccagcgacagcttctgggag
gttgggaactacaaacggactgtgaagcggattgacgatggccaccgcctgtgtggtgac
ctcatgaactgtctgcatgagcgggcacgcatcgagaaggcgtatgcacagcagctcact
gagtgggcccgacgctggaggcagctggtagagaagggaccacagtatgggaccgtggag
aaggcctggatagctgtcatgtctgaagcagagagggtgagtgaactgcacctggaagtg
aaggcatcactgatgaatgaagactttgagaagatcaagaactggcagaaggaagccttt
cacaagcagatgatgggaggcttcaaggagaccaaagaagcagaggatggctttcggaag
gcccagaagccctgggccaagaagctgaaagaggtggaagcggcaaagaaggcgcaccac
acagcgtgcaaagaggagaagctggccatctcccgggaagccaacagcaaggcagatcca
tccctcaaccctgagcagctgaagaaactgcaagacaagatagaaaaatgcaaacaggac
gttctaaagaccaaggacaagtatgagaagtccctgaaggagcttgatcagaccacaccc
cagtacatggagaacatggagcaggtgttcgagcagtgccagcagtttgaagagaagcgc
ctgcgcttcttccgggaggttctgctggaggttcagaagcacttggatctgtccaatgtg
gctagctataaaaccatttaccgggagctggagcagagcatcaaagcagcagatgcggta
gaggacctgaggtggttccgggctaaccatgggccaggcatggctatgaactggccacag
tttgaggagtggtctgcagatctgaatcgaactctcagccggagagagaagaagaaggct
gttgacggtgtcaccctaacagggatcaaccagacaggtgaccagtctggacagaacaag
cctggcagcaaccttagtgtcccgagcaaccccgcccagtccacgcagttacagtccagc
tacaaccccttcgaggacgaggacgacacgggcagcagcatcagtgagaaggaggacatt
aaggccaaaaatgtcagcagctatgagaagactcagacttaccccactgactggtctgat
gatgagtctaacaaccctttctcctccacggatgccaacggggattcgaacccatttgat
gaggacacgacctcaggaacagaagtgcgagttcgggccctctatgactatgaggggcag
gaacatgatgagctgagcttcaaggctggggatgaactgaccaagatagaggatgaagat
gaacagggttggtgcaagggacgtttagacagcggccaggttggcctatacccagccaac
tatgtcgaggctatccagtga

DBGET integrated database retrieval system