KEGG   Mus musculus (mouse): 239739Help
Entry
239739            CDS       T01002                                 

Gene name
Lamp3, 1200002D17Rik, Cd208, DC-LAMP, DCLAMP, LAMP, TSC403
Definition
(RefSeq) lysosomal-associated membrane protein 3
  KO
K06562  lysosomal-associated membrane protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    239739 (Lamp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    239739 (Lamp3)
CD molecules [BR:mmu04090]
 Proteins
  239739 (Lamp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lamp ATP-synt_S1
Motif
Other DBs
NCBI-GeneID: 239739
NCBI-ProteinID: NP_796330
MGI: 2441659
Ensembl: ENSMUSG00000041247
UniProt: Q7TST5 Q8BZW9
Position
16; 16 A3
AA seq 411 aa AA seqDB search
MPGQISAVAVLFLSLTVILHGYQIREKEFPKARGYLQYTATSAEQITTKPLLQLINQRSH
ITLASRFKDDYIQMAAETSAIENTAHITMKTVTPVTTKSLPPISSASYTFVRSNNAHMTA
SSTDDTIGSGSIAHLPVPTTRASLAIVNYITGRATQLGGQTTLPKTFFTASHKSTTNQRP
TLSTNVLGTSTPTHKDRSTTSPVPLVPRPTLVTWSSPAKIGTYEVLNGSRLCIKAEMGLA
LIVQEKDLDSATQRYFNIDPSLTHASGKCDSQKSNLFLNFQGGSVNITFTKEENLYYISE
VGAYLTISNTEKTYQGKKNTLMMFETVVGHSFKCVSEQSIQLSAQLQMKTMNIHLQAFDF
EGDSFGNVNECLSDYTVVLPMVAIIVVVICVVGLSVYKIRQRHQSSAYQRI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggcagatctctgcagtagctgtactcttcctgtccctgactgtaattttacat
ggctatcaaataagagaaaaagaatttccaaaagccagaggctatcttcaatatactgca
acatcagcagaacagatcacaacaaaacctctactacaactgattaaccaaagatctcat
ataactttagcatcaagattcaaggatgattacattcaaatggctgctgaaacttcagcc
attgaaaacacagcccatataacaatgaaaacagtaaccccagtaactacaaagagcctt
ccacccatcagctcagctagttatacctttgtcagatctaataacgcacacatgactgct
tcatctactgacgataccattggctctggctcaattgcacatttaccagttcctacaacc
agagctagtctagccattgtcaactatataactgggagagctacacaacttggtggtcag
actacccttcccaaaacatttttcacagcatcacacaaaagcacaaccaatcagaggcca
actctgtccactaatgtcttaggaacatcaacacctacacacaaggacagatcaacgacc
tcacctgttcccctagttcctaggcctactcttgtaacttggtcatcaccagccaagatc
ggaacttatgaagtcctaaatggaagcaggctctgtattaaagcagagatgggactagca
ctgattgttcaagaaaaggatttggattctgcaacccaaagatatttcaacattgacccc
agcctaacccatgcatctgggaaatgtgactcccaaaaatccaacctcttcttgaatttc
cagggtggatctgtgaatatcacatttaccaaggaagaaaacttatattatattagtgaa
gttggagcatatttgaccatctcaaatacagagaagacttaccagggaaagaagaatact
ttgatgatgtttgagacagtagttgggcattccttcaagtgtgtcagtgagcagagcatc
cagctgtcagctcagcttcaaatgaaaacaatgaatatccaccttcaggcctttgatttc
gaaggagactcctttggaaatgtgaacgagtgtttgtctgactacacagttgtgcttcct
atggttgcaatcatcgtggtcgtcatctgtgttgtgggtctgagtgtttacaaaatccgc
caaaggcatcagtcatctgcataccagagaatctaa

DBGET integrated database retrieval system