KEGG   Mus musculus (mouse): 239766Help
Entry
239766            CDS       T01002                                 

Gene name
Rtp1, Gm1766, Gm604
Definition
(RefSeq) receptor transporter protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-3CxxC IL12p40_C
Motif
Other DBs
NCBI-GeneID: 239766
NCBI-ProteinID: NP_001004151
MGI: 2685450
Ensembl: ENSMUSG00000033383
UniProt: Q8C8C1 B2RSL5
Position
16; 16 B1
AA seq 263 aa AA seqDB search
MRIFRPWRLRCPALHLPSFPTFSIKCSLPPLPTDEDMCKSVTTGEWKKVFYEKMEEVKPA
DSWDFIIDPNLKHNVLAPGWKQYLELHASGRFHCSWCWHTWQSPHVVILFHMYLDKAQRA
GSVRMRVFKQLCYECGTARLDESSMLEENIESLVDNLITSLREQCYGERGGHYRIHVASR
QDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKPQAETGSGCNFCSIP
WCLFWATVLMLIIYLQFSFRTSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttttagaccgtggagactgcgctgccctgccttacacttaccctctttcccc
acgttctctataaagtgtagtttgcctcctcttcccactgacgaagacatgtgtaagagt
gtgaccacaggtgagtggaagaaggtcttctacgagaagatggaggaggtgaagccagcg
gacagctgggacttcatcatagaccccaacctcaagcacaatgtgttggcccctggctgg
aagcagtacctggaacttcatgcctcaggcaggttccactgttcctggtgctggcacacc
tggcagtcaccccatgtagtcatcctcttccacatgtacctggacaaggctcagcgcgct
ggttcggtgcgcatgcgtgtgttcaagcagctctgctacgagtgcggtacagcacggctg
gatgagtccagcatgctggaggagaacatcgaaagcctggtggacaacctcatcaccagt
ttgcgagagcagtgctacggggagcgtggtggccactaccgcatccatgtggccagccgg
caggacaaccggcgacaccgcggagagttctgcgaggcctgccaggaaggcatcgtgcac
tggaagcccagtgagaagctgctggaggaggaggcgaccacctacaccttctcccgtgct
cccagccccaccaaaccgcaggctgaaacaggctcaggctgcaacttctgctccattccc
tggtgcttattttgggccacggttttgatgctcatcatctacctgcaattctccttccgt
acttctgtctaa

DBGET integrated database retrieval system