KEGG   Mus musculus (mouse): 239796
Entry
239796            CDS       T01002                                 

Gene name
Mb21d2, 1600021P15Rik, A430031N04, C87006
Definition
(RefSeq) Mab-21 domain containing 2
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Mab-21
Other DBs
NCBI-GeneID: 239796
NCBI-ProteinID: NP_808386
MGI: 1917028
Ensembl: ENSMUSG00000051065
UniProt: D3Z742
Position
16; 16 B2
AA seq 491 aa
MKMAAPTASKAASLGCNNKPAFPELDFRSGARVEELNKLIQEFTRHDQREYDDQRALEIH
TAKDFIFSMLGMVQKLDQKLPVANEYLLLSGGVREGVVDLDLDELNVYARGTDYDMDFTL
LVPALKLHDRNQPVTLDMRHSALCHSWLSLRLFDEGTISKWKGCCTIADHINGATNYFFS
PTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGVGSSRMLYDIVPVVS
FKGWPAVAQSWLMENHFWDGKITEEEVISGFYLVPACSYKGKKDNEWRLSFARSEVQLKK
CISGSLMQAYQACKAIIIKLLSRPKAISPYHLRSMMLWACDRLPASYLAQEDYAAHFLLG
LIDDLQHCLVNKMCPNYFIPQCNMLEHLSEETVMLHARKLSSVRSDPAEHLRTAIEHVKA
ANRLTLKLQRRGSTTSIPSPQSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVT
RPHFRIDDKFF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaagatggcggctcccaccgccagcaaggcagcctccctgggctgcaacaacaagcct
gccttcccggagctggatttcaggtctggagctcgggtggaggaactgaacaaactcatc
caggaattcaccaggcacgaccagcgggaatacgacgaccagagagcgctggagatccac
actgccaaggatttcatcttttccatgctgggaatggtgcaaaagctagatcaaaaactt
cccgtggccaacgagtatctgttgctctccggaggagtccgggaaggtgtggtggacctg
gacctagatgagttaaacgtctatgcccggggcactgactacgatatggactttaccctt
ctggtgcccgcccttaagctgcatgaccgtaaccagcctgtgacgctcgatatgcgccac
tcagccctgtgccactcctggctgagcctcaggctctttgatgaggggacaatcagtaaa
tggaaaggttgctgcacaatcgccgatcacatcaacggtgccaccaactacttcttctcc
cccaccaaagtggctgactggttctatgactccatcagcatcgtcctctcggagatacag
aagaaaccccagagagggatgccgaaggtggagaaggtagagaagaacggtaccatcatc
tccatcattctgggcgtggggagcagccgcatgttgtacgacatcgtccccgtggtgtcc
ttcaaaggctggcccgcggtggctcagagctggctcatggagaaccacttttgggatggg
aagatcaccgaagaagaggtcatcagtggcttctacctggtgccagcttgctcctacaaa
ggcaagaaggacaatgagtggcgactgtccttcgccaggagcgaggtacaactgaagaag
tgcatttcaggcagtctaatgcaggcctaccaagcctgcaaagccatcatcatcaaactc
ctgtcgaggcccaaggccatcagcccttatcacctgcggagcatgatgctctgggcctgt
gatcgactccctgccagctacttggctcaagaagactatgcagcccactttttgctgggc
ctcattgacgacctgcagcactgcctggtcaacaagatgtgccctaattatttcatccct
cagtgcaacatgctggagcatctgtcagaggagacagtcatgctccacgcccggaagctc
tcctcggttcgctccgatcccgcagagcacctgcgcaccgccattgagcacgtgaaggca
gccaatcggctgacgctgaagctccagcgtcggggcagcaccaccagcatcccctcccca
cagtcggatggcggggaccccaatcagcctgatgaccgtctggcaaaaaaactgcagcag
ctagtgactgagaatccagggaagtccatctcggtctttattaaccccgatgacgtcacg
aggccccatttcagaatcgatgataaatttttctga

DBGET integrated database retrieval system